(data stored in ACNUC9543 zone)

EMBL: AL844507.PE168

AL844507.PE168       Location/Qualifiers
FT   CDS_pept        complement(777257..779647)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817200"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0061:mRNA"
FT                   /db_xref="GOA:Q8IB08"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB08"
FT                   /protein_id="CAD51202.1"
FT                   /translation="MVVKKISGDIIQHYVGKNDFKRKCFKTLDICKNNKSTLRIIDLKS
FT                   YVKNLILGLSNDELSRYQNMFNKINKRNNKYNNLFYNISKDCNNKIQMNGKKKSSNIQN
FT                   VCKYNCDMQNKNSLFNYDIMYRNNISIFLKRRNNFHTLNKIFRKGNDVIQDNTKCKEYK
FT                   NSINNMKMNKKDEFNINNDINKNDSNNKIYEIYEILHKYEKSINFYKYMFIMNSLVVIL
FT                   ILCGLFVFTGDIINKYIINKIEKVLEDIKNSKEIENNLKEIINSLIYNVVVQEKNKMIT
FT                   SAFFIDVLKNSRKDMENVFIDILETEQVKNKLRNVFQDISIYLCNNKEVQKKVAYLLAE
FT                   AIHLPVSISISKKWLNDLFNSEEVTQNMRNIIYKELFKNDEMINHSIGYLQYILLNTLQ
FT                   NKNTHEMTKLFLNSILSNQEFQIQLSENVWKIFKLALSPKWMNNEDFKIVLKDSRGVEK
FT                   IIKKEFNVNNKNVNTISCEMDNTINSNGNYSSTDHLSLINKNFSSDENNSINNHRCDDK
FT                   NNYKYDDKNNYKYDDKNNYKYDDTKNHNDDSAYMSVVASEEAKTKMNIKYIDEKLNKDK
FT                   IKYIDNLKNTEKKKSIDGNIFIPLNYPINHTCNDHRMCNICQHFNQKLKNEIKFILHIF
FT                   QNYDENNEKNIRTNNNSISIKPYENQNNLNFNQEVNKTLQLNIITDTLKSLLNSSHIFF
FT                   DKTILRIPTYKIQNVHEMHAKFTYPFLLNIFKHMNTNTDKKKSQSTQDNLNPIQKVIYK
FT                   YSLKEKLYLNLVDMFLFYSYKYYFYYYYVIKLKYILYDHFKDK"
     atggttgtaa aaaaaatatc aggagatata atacaacatt atgtagggaa aaatgatttt        60
     aaaagaaaat gttttaaaac attagatata tgcaaaaata ataaatcaac tttacgtatt       120
     atcgatttaa agagttatgt taaaaactta atattagggc tatcaaatga tgagctgtca       180
     agatatcaaa atatgtttaa caaaataaat aaaaggaata ataaatataa taatttattt       240
     tataatatat caaaagattg taataataaa atacaaatga atggaaaaaa gaaaagtagt       300
     aacatacaaa atgtatgtaa atataattgt gatatgcaga ataaaaattc tttatttaat       360
     tatgatataa tgtatagaaa caatataagt atttttctga agagaaggaa caatttccat       420
     acgttgaata aaatatttcg aaaaggaaac gatgtaatac aagataatac aaaatgtaaa       480
     gaatataaga attcaattaa taatatgaaa atgaataaaa aggatgagtt taatattaat       540
     aatgatataa ataagaatga tagtaataat aaaatatatg agatatatga gatattacat       600
     aaatatgaaa agagtattaa tttttataaa tatatgttta ttatgaatag tttagttgtg       660
     atattaattt tatgtggttt gtttgttttt acgggagata taataaataa atatattata       720
     aataagattg aaaaagtatt agaagatata aagaattcaa aagaaattga aaataaccta       780
     aaagaaatta ttaatagttt aatatataat gtagtagtac aagagaaaaa taaaatgata       840
     acttcagctt tttttattga tgtattaaaa aattcaagaa aagatatgga aaatgtattt       900
     atagatattt tagaaaccga acaagtaaaa aataaattaa gaaatgtatt tcaagatata       960
     tctatatatt tatgtaataa taaagaagtc caaaaaaaag tagcatactt attagcagaa      1020
     gcaatacatt taccagtatc aatttctata tccaaaaaat ggttaaatga tttatttaat      1080
     tcagaagaag ttacacaaaa tatgagaaat attatatata aagaattatt taagaatgat      1140
     gaaatgataa atcattctat tggatattta caatatatac ttctaaatac attacaaaat      1200
     aaaaatacac atgaaatgac caaattattt ttgaattcta tattatcaaa tcaagagttc      1260
     caaatacaac tttcagaaaa tgtctggaaa attttcaaat tagccttatc cccaaaatgg      1320
     atgaataatg aagactttaa aattgtttta aaagatagta gaggtgtgga gaaaataatt      1380
     aaaaaggaat ttaatgttaa taacaagaat gtaaacacta taagctgtga aatggataac      1440
     actattaata gtaatggtaa ttatagtagt acggatcatt tatcgctcat caataaaaac      1500
     ttttcaagtg atgaaaataa tagcattaat aatcacaggt gtgatgataa aaacaattat      1560
     aaatatgatg ataaaaacaa ttataaatat gatgataaaa acaattataa atatgatgat      1620
     actaaaaacc ataatgatga tagtgcttat atgtctgtgg tcgcttctga agaggcaaaa      1680
     accaaaatga atatcaaata tatagacgaa aaactaaata aagataaaat taaatatata      1740
     gataatttaa aaaatacaga aaaaaaaaaa agtatagatg gaaatatttt tatcccatta      1800
     aattatccta ttaatcatac atgtaatgat caccgcatgt gtaatatttg tcaacatttt      1860
     aatcagaaat taaaaaatga aataaaattt attcttcata tttttcaaaa ttatgatgaa      1920
     aacaatgaaa aaaatattcg tacgaataat aattccatat ctataaaacc atatgaaaat      1980
     caaaataatt taaattttaa tcaggaagta aataaaacat tacaattaaa tattataaca      2040
     gacactttaa aatctttatt aaattcttct catatctttt ttgataaaac cattttgcgt      2100
     atccctacat ataaaattca aaatgttcat gaaatgcacg caaagtttac atatccattc      2160
     ctactcaata tttttaaaca catgaatacg aatacagata aaaagaaatc acaatctacg      2220
     caagataatt taaatcctat acaaaaagta atatacaaat actcgttaaa ggaaaaatta      2280
     tacttaaatt tagttgatat gtttttattc tattcttata aatattattt ctattattat      2340
     tatgtcatta aattaaagta catattgtat gaccatttta aggacaaata a               2391
//

If you have problems or comments...

PBIL Back to PBIL home page