(data stored in ACNUC9543 zone)

EMBL: AL844507.PE171

AL844507.PE171       Location/Qualifiers
FT   CDS_pept        join(798777..798807,799031..799136,799409..799503,
FT                   799639..799691,799804..799938,800068..800205)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817500"
FT                   /product="histidine triad nucleotide-binding protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817500"
FT                   /db_xref="GOA:Q7K6B1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q7K6B1"
FT                   /protein_id="CAD51199.2"
FT                   /translation="MGFKIVFIYLIFVCLMKIIPGFFTNKLTNSFYSTFVKLSYKNKFM
FT                   TGILTRRLAKMADEEERALEAAGKDENGDSIFGKIARGEVPVDAVYEDDKVIAFNDIYP
FT                   QAPVHIIVIPKRRDGLTRLSKAEEKHKEILGHLMWAVAEIVRKNNLGDFRLVVNNGPEA
FT                   CQSIYYLHLHILAKRQMKWPPG"
     atgggtttta aaatagtctt tatatattta atttttgttt gcttaatgaa aataataccg        60
     ggattcttta caaataaatt aacaaattca ttttatagta catttgttaa actatcctac       120
     aagaataaat ttatgactgg aatattaaca agacgattgg caaagatggc ggatgaagaa       180
     gaaagagcat tagaagctgc aggaaaagat gaaaatggag attcaatttt tggaaaaatt       240
     gcaagaggtg aagtacccgt tgacgctgta tatgaagatg ataaagtcat cgcatttaat       300
     gatatatacc cacaagcacc agtacatatt atagtcatac caaaaaggag agatggtctt       360
     actagactaa gcaaggcaga agaaaaacat aaagaaattt taggacattt aatgtgggct       420
     gttgctgaaa ttgtaagaaa aaacaaccta ggagatttcc gattggtagt taacaatgga       480
     cctgaggcat gtcaatccat atactattta catttacata tattagccaa gagacaaatg       540
     aaatggcccc ctggttaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page