(data stored in ACNUC9543 zone)

EMBL: AL844507.PE172

AL844507.PE172       Location/Qualifiers
FT   CDS_pept        complement(join(800920..803696,803923..804034))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0058:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB11"
FT                   /protein_id="CAD51198.1"
FT                   /translation="MSSEVSAQIIKEDGFPKKTMNPPKKFPLLLKNKGKSPPFIQKNNI
FT                   TNNRDNDINVEGINSDISNKKFPPKLKAMKPKIKIPEPKFKAIEMKSDEKQSNMNNVQN
FT                   DMKKIMPKLKSIKPKIKIPEPKFKSLEQTIKKGESYIKSSNTNKEPPKSIMKQSSTNSN
FT                   NSQPILKRLQTSKKKVSIDLVDEEDDISNEKNFNKNSLFKNKYYSKINIIDKLKNVCSN
FT                   EINKNESNGSTKDPMGIGKIYYSIKEKGKAFQPSFSSSIKEKTITNIGTASFSQELAKQ
FT                   NIGSNQHMKRDNMSRNDPSNDIQNNSNNGPKRMSMEKISKNDNILENNTNVRQKSESHI
FT                   KMSNTCGENILVGIKGNKSNIGPLTTFNESKLIQDTHYINAFSRFSGNYVGKVTGPANS
FT                   ISNFDKTPQNMNDKKTCVQNGIHNNGYVCKGVPPPFYEYPYMMNYPYCNNVLYNGGMDN
FT                   HPFYFYPRFYLPMYPYDYPHNETVPFFNDENVIPNGNHISAAHKTTRRNKRDERNKHKG
FT                   KNNKFEDNMIIAGGHLKPLQFRNGAEWSKKNDQKKFNDGEEVYYDDDNYDSYDDVDEEE
FT                   YFDWDEYNNEDKFYEEQNKIKHKQKSSYIGNSKWYEIEQKLNNCRGVIEDDKPPKEIII
FT                   KKKKSVNEKKKKKPYYEEETKYYDEYESEYSYTYDGEYNDVYISDDQLINPKMYKNGVY
FT                   NRRRLSNRNEKHGLEQNTLEDTYNFNFDDIYKNYRIEYLNEKLKWANEHLKKKKNNKYK
FT                   KNQKDEITIDQDKANDPTLIQGPRKKNLERLEDIAHLFLPKQKKHDNMFNLSLNISKMS
FT                   NNDKNDIINMLFSCRELEKLIEEQHCVLDMLDNDLREVNASLKLPATWDNLENFELLQE
FT                   NILKEDEQGLPINNTPFFIKGKVALIPKDINTFFDDEKKGESTGKKDYYARQVVQMATQ
FT                   VNTPTPVKYVPKFTKAKVKPKVPLLLKNITKA"
     atgagttcag aggtttctgc tcaaataatt aaagaagatg gatttccaaa gaaaacaatg        60
     aatccaccta agaaatttcc tttattatta aaaaataaag gaaagtctcc accttttatt       120
     caaaaaaata atatcacaaa taatagagac aatgatataa atgtggaagg cattaattct       180
     gatatttcaa acaaaaaatt tccacccaaa ttaaaagcga tgaaacccaa aataaaaata       240
     cctgaaccaa aatttaaagc aatagaaatg aaaagtgatg aaaaacaatc aaatatgaac       300
     aatgttcaaa atgacatgaa aaagattatg ccaaaactga aatccatcaa gccaaaaata       360
     aaaatacctg aaccaaaatt taaatcatta gaacaaacta ttaaaaaagg agaatcatat       420
     atcaagtctt caaatacaaa taaggaacca ccaaagtcca ttatgaaaca atccagtact       480
     aatagtaata attcacaacc catattaaaa agacttcaaa catccaaaaa aaaagtgtct       540
     attgatttag ttgatgagga agatgatata tcaaatgaaa aaaattttaa taaaaattca       600
     ttattcaaaa ataaatatta ttcaaaaata aatattatag ataaattaaa aaatgtttgc       660
     tccaacgaaa taaacaagaa tgaatcaaat gggtctacaa aagatcctat gggaataggt       720
     aaaatatatt attccataaa agaaaaagga aaagcttttc agccctcatt ttcttcctct       780
     atcaaagaga aaacaataac aaatattggc actgcatcat tttcacaaga attggcaaaa       840
     caaaatatag gaagtaacca acatatgaaa cgtgacaaca tgtcaagaaa tgatccttca       900
     aacgatatac aaaacaattc aaataatggt ccaaaaagga tgtcaatgga aaaaatctcg       960
     aaaaatgata atatattaga aaataataca aatgttagac aaaagagtga atcacatatt      1020
     aaaatgtcaa atacatgtgg agaaaatatc ctagtaggaa taaaaggaaa taaatccaac      1080
     ataggaccat tgacaacatt taatgaaagt aaattaattc aagatactca ttatataaat      1140
     gctttttctc gatttagtgg gaattatgta ggtaaagtta caggacctgc taattctata      1200
     tctaactttg ataaaactcc acaaaatatg aatgacaaaa agacatgtgt tcaaaatggt      1260
     attcataata atggatacgt gtgtaaggga gtaccaccac ccttttatga atatccttat      1320
     atgatgaatt atccatactg taataatgta ttatataatg gtggaatgga taatcaccct      1380
     ttttattttt accctagatt ttacttaccc atgtatccat atgattatcc acataatgag      1440
     accgtaccat tttttaatga tgaaaatgtt ataccaaatg gaaatcatat tagtgctgcc      1500
     cataaaacga caagaagaaa taaaagagac gaaagaaata aacacaaggg aaaaaataac      1560
     aaatttgaag acaatatgat tatagctggg ggacatttaa aaccattgca atttagaaat      1620
     ggagcagagt ggagtaagaa gaatgaccag aaaaaattta atgatggtga agaagtatat      1680
     tacgatgatg ataattatga tagttacgat gatgttgatg aggaggaata ttttgattgg      1740
     gatgaatata ataatgaaga caaattctac gaagaacaaa ataagataaa acataaacag      1800
     aaaagttcat atattggaaa ttcaaaatgg tacgaaattg aacagaaatt gaataattgt      1860
     cgaggggtca tagaagatga taaaccacca aaagaaataa ttataaagaa aaaaaaaagt      1920
     gtgaatgaaa aaaaaaaaaa aaaaccttat tacgaagagg aaacaaaata ttatgatgag      1980
     tatgaaagtg aatatagtta tacatatgat ggtgaatata atgatgtata tatttctgat      2040
     gatcaattaa taaatccgaa aatgtataaa aatggtgtat ataatagaag aagattaagt      2100
     aatagaaatg aaaagcatgg tttggaacaa aacacattgg aagatacata taatttcaat      2160
     tttgatgata tatataagaa ttacagaatc gaatatttaa atgaaaaact taaatgggcc      2220
     aacgaacatt tgaaaaaaaa gaaaaataat aaatataaga aaaaccaaaa ggatgaaatt      2280
     accatagatc aggataaagc aaatgatcct actcttatac aaggaccacg aaaaaagaat      2340
     ttggaacgtt tagaagatat agctcattta tttttaccaa aacagaaaaa acatgataac      2400
     atgtttaatt tatcattaaa catttcgaaa atgtctaata atgataagaa cgatatcata      2460
     aatatgcttt tctcttgtcg agaattagaa aaattaattg aagaacagca ttgtgttttg      2520
     gatatgttgg ataacgattt acgagaagtt aatgcatcat taaagttacc agcaacttgg      2580
     gacaatttgg aaaactttga attattacaa gaaaatattt taaaggaaga tgaacaagga      2640
     ttgccaataa ataatactcc tttttttata aaaggaaagg tagcactaat accgaaggat      2700
     ataaatacct tttttgatga tgaaaaaaaa ggtgaatcaa caggaaaaaa ggattattat      2760
     gctaggcagg tggttcaaat ggcaactcag gtgaatactc caacgcctgt taaatatgtt      2820
     ccaaaattta cgaaagcaaa agtaaagccc aaagtgccct tgttattgaa aaatattact      2880
     aaagcttaa                                                              2889
//

If you have problems or comments...

PBIL Back to PBIL home page