(data stored in SCRATCH zone)

EMBL: AL844507.PE173

AL844507.PE173       Location/Qualifiers
FT   CDS_pept        complement(join(805797..805909,806037..806138,
FT                   806258..806320,806418..806489,806606..806680,
FT                   806840..806905,806995..807039,807147..807203,
FT                   807343..807375,807506..807535,807633..807665,
FT                   807804..807842,807982..808056,808155..808373,
FT                   808550..808927,809059..809433,809657..810047,
FT                   810247..810440,810565..810687,810802..810882,
FT                   810973..811095,811240..811320,811463..811528,
FT                   811726..811800,811902..811961,812115..812303,
FT                   812452..812478,812655..812687,812972..813085,
FT                   813221..813298,813405..813465))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817700"
FT                   /product="rhoptry neck protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817700"
FT                   /db_xref="GOA:C0H4V4"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V4"
FT                   /protein_id="CAX64131.1"
FT                   /translation="MLKYTLLIYIIAGYFISEISNKLFDTLLPRNVFKKPKPFKKNEIK
FT                   KGIDKDEKSIMKNVDSIDVMFEPRVKRFVPSRTRKTHVVGGLSQSIPDPGDVEKSKYEK
FT                   AVRFFENIKNEMINMSSKINKQLDSQDISSLNNFKRASEVLKESLATMHSLDIIRNDGS
FT                   VDFSKYTLDWYSKANMREKYSIEKSIQKIMNKLFKKARKKKKNMKKKKIDANIEQLEMD
FT                   LLVQKFITENLNASKLLKLYDDSANDYVSPMHTDVCGQLGSIIFSYMFEKAYKSSINHD
FT                   ISYFQKYLPRLKYRIQNMIQKGTLLLLEKGLDDSLYTFKSKISDIMEKKFGFNDMCTDK
FT                   CMDETIKADYDLSEYKNEFSPSKTAQRRADLVKLLMYYYRDKIYNIETSADVVLIMLLY
FT                   LNSANELSEKGYLDVSSISTDDEFNLINKTIDRSHKFNKKIKIKKKTFFKIAPFNFFRE
FT                   ETQEKTGNESIFAIDDIIKTSLLAKKSQNYNSLYETTKDLWNQIQNMYSASYGFVQSKK
FT                   IKTNKFVGSKIRNVGFLLRWFNYNKTPSKNINFLVNNFSPLVSISLQLVFFITTMIEQY
FT                   ESSFLGNFSSALKKIFTLGKSGRNPRNYNDLVNFSEVDYLLRTSKANNVQRIIMQIIRM
FT                   LKKKFLSSSYTPTLLAQYMSIFLSLWVFEGENNISLQNPNISRFKKIFFLTYFVHEKGP
FT                   VEKAVDIIYNKCRMKTDKIVLGCIHDYGGREKKKLLGLISRKCKPTKISIRKRSIRKIL
FT                   NKLMSSLNDPVDILRIAVDTATRCDHFNRSKNIDNVKTKKNKINYEIFVKSELSIRYIC
FT                   ADVTKNVVKKIIRDVSRLKNMREAQNVIDNGLNSVQYLKIRNYRDKESSFTILCPFMEG
FT                   NDKNIRELERTQISLFIHKNIGMSRIIKGKLINIFKKTLNMREGIKSDSAISIKVGARK
FT                   YNGIIFTGGYQLNVDNLDQNTLHIGLSKTRKVYDGRKYVDELEILKGDGVKNIYMKGLN
FT                   EDNERIYELQNNMRVSEFDYAIQNPEANIIVFDGNNYISSYALRNMGLEHERIVWAGPS
FT                   VGWTAEFALSAISDNPLPIFDGSAWVLLEKLSIRSILGKHLPSDVNGNSLANTVNFVIL
FT                   NKDGKPILKNTTPVINLKYATFTLSGIVNFVIKAEKGIGNEIIVHTRIP"
     atgttgaaat acactttgct catatatatc attgcgggtt atttcatatc agaaatatca        60
     aacaaacttt tcgatacact tcttccacga aatgtcttta aaaaacccaa accatttaag       120
     aaaaatgaaa taaaaaaggg tattgataag gatgaaaaat ctattatgaa aaatgtagac       180
     tcgatagatg ttatgttcga accaagggtt aaaaggttcg tcccttctag gacaagaaaa       240
     actcatgttg taggtggtct tagtcaaagt atacctgacc caggagatgt ggaaaagagc       300
     aaatatgaaa aagccgtacg attctttgag aatataaaaa acgaaatgat aaatatgtca       360
     tctaaaatta ataaacagct agatagtcaa gatataagtt ccttgaataa ttttaagaga       420
     gcatctgaag tactaaaaga aagtctagca acaatgcatt cattggatat tattagaaat       480
     gatggcagtg tagatttctc aaaatataca ttggactggt attccaaagc taacatgaga       540
     gaaaaatatt ctatcgagaa aagtatacaa aaaattatga ataaactttt taaaaaggca       600
     cgtaaaaaga aaaaaaatat gaagaagaaa aagatagatg ccaatattga acaacttgaa       660
     atggatttat tagtacagaa atttataacg gaaaatctga acgcaagcaa attattaaaa       720
     ctatacgatg actctgccaa tgattacgtt tccccaatgc acactgatgt atgtggacag       780
     ctaggaagta taattttcag ttatatgttc gagaaggcat acaaatcatc gataaatcac       840
     gacatatcat attttcaaaa atacttacct cgtctgaaat atagaattca aaatatgatt       900
     caaaagggaa cactattatt actagaaaag ggtcttgatg attctttata tacatttaaa       960
     tccaaaattt cagatataat ggaaaaaaaa tttggattta atgatatgtg tacggataaa      1020
     tgcatggatg agactattaa agcagactat gatttatctg agtataaaaa tgaatttagt      1080
     ccatcaaaaa cggcacaaag aagagcagat ttggtcaagt tattaatgta ttactacaga      1140
     gataaaatat ataatatcga aactagtgct gatgtcgttt taattatgtt attatattta      1200
     aattcggcaa atgaactttc ggaaaagggt tatcttgatg ttagttctat atcaacagat      1260
     gatgaattca atttaataaa taaaacaatt gacaggagtc ataagtttaa taaaaagatt      1320
     aaaataaaga agaaaacgtt ctttaaaata gctcctttta attttttccg agaagaaaca      1380
     caagagaaaa caggaaatga atccatcttt gctattgacg atattataaa aacttcttta      1440
     ttagctaaga aatctcaaaa ttataattcg ttgtatgaaa caacaaaaga tttatggaat      1500
     caaattcaaa atatgtattc tgcatcatat ggttttgtac aatccaaaaa aatcaaaaca      1560
     aataaatttg ttggatctaa aatcagaaat gtaggattct tgcttagatg gtttaattat      1620
     aataagacac catctaaaaa tattaatttc ttagttaata acttttctcc tttagtttcg      1680
     atcagtttac aattagtgtt tttcataacg accatgatag aacaatacga atcgagcttc      1740
     ctaggaaatt tctcatctgc ccttaagaaa atttttaccc taggaaagag tggaaggaat      1800
     ccaagaaatt ataacgactt agttaatttt tctgaagtag actatttact aagaacatct      1860
     aaggcaaata atgttcaaag aattattatg caaattatta gaatgttgaa aaagaaattt      1920
     ttatcttctt catatacacc tacattattg gcccagtata tgtctatctt cctttcttta      1980
     tgggtatttg aaggagaaaa taatatatcc ttacaaaacc caaatatatc cagatttaag      2040
     aaaatctttt tccttacata ctttgttcac gagaaaggac ctgttgaaaa ggctgtagat      2100
     attatataca acaaatgtcg aatgaaaacc gacaaaattg ttcttggatg tatacatgat      2160
     tatggaggta gagaaaagaa aaaactcctc ggactaataa gtagaaaatg taaacctaca      2220
     aagataagta taagaaaacg aagtattcgt aaaattctaa acaaactcat gagctcatta      2280
     aatgatccag tagatatttt aagaattgcc gttgatacgg cgacaagatg tgatcatttt      2340
     aatcgtagta aaaatattga taatgtaaaa acaaaaaaaa ataaaataaa ttatgaaata      2400
     tttgtaaagt cagagttatc cattagatat atctgtgcag atgttacaaa aaatgtcgtt      2460
     aaaaaaatta tcagagatgt atctagactt aaaaatatga gagaagcaca aaatgtcata      2520
     gacaacggat taaatagtgt acagtattta aaaataagaa attacagaga taaggaaagt      2580
     agtttcacaa ttttatgtcc attcatggaa ggaaacgaca aaaacataag agaactcgag      2640
     agaacccaga tatctctttt tattcacaaa aacattggaa tgtctagaat aatcaaagga      2700
     aaattgatca atatatttaa aaaaacactt aatatgaggg aaggtattaa atcagatagt      2760
     gccatatcta taaaagttgg agcacgtaaa tataatggta tcatattcac aggaggatat      2820
     caattgaacg ttgataattt ggatcaaaat acacttcata ttggattatc aaaaacaaga      2880
     aaagtatatg atggaagaaa atatgtagat gaactagaaa tattaaaagg agatggtgtt      2940
     aaaaatatat atatgaaggg actaaatgaa gataatgaaa gaatttatga gcttcagaat      3000
     aatatgaggg tatctgaatt tgactacgcc atacaaaatc ccgaagctaa cataattgtt      3060
     tttgatggaa ataattatat atcatcttac gcacttcgca atatgggact tgaacatgaa      3120
     agaattgttt gggctggtcc aagtgtagga tggacagcag aatttgcctt aagtgccatc      3180
     tctgataacc cactaccaat attcgatgga tctgcttggg tattacttga gaaattaagt      3240
     atcagaagta ttttaggtaa acatttacca agtgatgtta atggaaattc attggcaaat      3300
     acagtcaatt ttgttatttt aaacaaagat ggaaaaccaa tattgaaaaa cacaacacct      3360
     gttattaact taaaatatgc tacctttaca ttatctggta ttgtaaattt tgtcataaaa      3420
     gcagaaaagg gaataggaaa tgaaattatt gtacacacta gaatacctta a               3471
//

If you have problems or comments...

PBIL Back to PBIL home page