(data stored in ACNUC9543 zone)

EMBL: AL844507.PE175

AL844507.PE175       Location/Qualifiers
FT   CDS_pept        complement(816803..817102)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817900"
FT                   /product="high mobility group protein B2"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.72:mRNA"
FT                   /db_xref="GOA:Q8IB14"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="PDB:2MRC"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB14"
FT                   /protein_id="CAD51195.1"
FT                   /translation="MASKSQKKVLKKQNKKKKKDPLAPKRALSAYMFYVKDKRLEIIKE
FT                   KPELAKDVAQVGKLIGEAWGQLSPAQKAPYEKKAQLDKVRYSKEIEEYRKKNQE"
     atggcttcaa aatctcaaaa gaaagtatta aaaaaacaaa acaaaaaaaa gaaaaaagac        60
     ccattagctc caaagagagc tttgtctgcc tatatgtttt atgttaagga taagagacta       120
     gaaataataa aagaaaaacc agaattagca aaagatgttg cacaagttgg taaattgata       180
     ggtgaagctt ggggacaatt aagcccagct caaaaagcac catatgaaaa gaaagcacaa       240
     ttagacaaag tacgatattc aaaagaaata gaagaatata gaaagaaaaa tcaagaataa       300
//

If you have problems or comments...

PBIL Back to PBIL home page