(data stored in ACNUC9543 zone)

EMBL: AL844507.PE177

AL844507.PE177       Location/Qualifiers
FT   CDS_pept        join(824564..826102,826441..826518)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818100"
FT                   /product="zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.70:mRNA"
FT                   /db_xref="GOA:Q8IB16"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB16"
FT                   /protein_id="CAD51193.2"
FT                   /translation="MACTPLLSEEDLYRFRTKQCLRLAKGLCEFGLDRCQYSHSAEWIR
FT                   RCPYYISLPSYLRYIPVACPYFIKNKNETEEDIEKRNMILKNCVHLTNKDGSVNNKFYK
FT                   YIEETNINKCPLGVECPLAHSIDEIDYHPLVYKTKRCENYMHANCNKYYCNNLHGLAEQ
FT                   RKIKEYFIPYSNKIDIPAYPNVTIVSKIQYGSFKGQTQLSNNQKKMNTDFNLNSRNFNY
FT                   PCKMINGKNYKHIDLKYNSINLPCQQRYTLQEQKMNQPKRYTTSNLMNMQPSHPNFSFS
FT                   CENQLKNKKKNSIFSYLNNFDDKFTLYLHILKKFPYLFDLNISDMNNENSGSFIRTQEL
FT                   TDNSSKGNLIDLTNMTNMKNDDNIGISSKNNIQDIYEKEFSKNNSQSINDSQNKYNTFE
FT                   QCTENIFMNNSYCEILNHIFKKNLQITKNKITCENATQRSFNDMEKYYTKNSSDNVDLD
FT                   FIRNLNGNYLNADNKIETYDDVLNMLSHILCLLYFTSDSRAHATFDTYAHKLAKQLNFE
FT                   SRKRKEMSIPKYLNYNMKEMI"
     atggcgtgca cacctttact tagcgaagaa gatttatacc gattcagaac gaagcaatgt        60
     ttacgtttag ctaagggttt gtgtgaattc ggtttggata gatgtcagta tagtcatagt       120
     gcggaatgga ttagacgttg cccttattat atttctttac cttcttattt aagatatatt       180
     cctgtagcat gtccatattt tattaagaat aagaatgaaa ccgaagaaga tatagagaaa       240
     agaaatatga tattaaagaa ttgtgttcat ttaactaata aagatggtag tgttaataat       300
     aaattttata aatatattga agagacaaat attaataaat gccctttagg tgtagaatgt       360
     cccttagcac atagtataga tgaaatagat taccatcccc ttgtatataa aactaaaaga       420
     tgtgaaaatt atatgcatgc aaattgtaat aaatattatt gtaataattt acatggttta       480
     gctgaacaaa gaaaaataaa ggaatatttt attccctatt caaataaaat agatattcca       540
     gcatatccta atgttaccat cgttagtaaa attcaatatg gttcatttaa aggacaaaca       600
     caattatcaa ataatcaaaa aaaaatgaat acagatttta atttgaattc aagaaatttt       660
     aattatccat gtaaaatgat taatggaaaa aattataaac atatagatct taaatataat       720
     tcaataaatc tgccttgtca acaaagatac acattacaag aacaaaagat gaaccaacct       780
     aaaagatata ctacatcaaa tttaatgaat atgcaaccct cgcatcctaa tttttctttc       840
     tcttgtgaaa atcaattaaa aaataaaaaa aaaaattcta tttttagcta cctaaacaat       900
     tttgatgata aatttacatt atatctacat atattaaaga aatttccata tctttttgat       960
     ttaaacattt ctgatatgaa taacgaaaat tcaggatcat tcatacgaac acaagaatta      1020
     acggataatt catctaaagg gaatctgatc gatttgacaa atatgacaaa tatgaaaaat      1080
     gatgataata taggcatttc tagtaaaaat aatattcaag acatatatga aaaagagttt      1140
     tccaaaaata actcacaaag tataaatgat tctcaaaata aatataacac atttgagcaa      1200
     tgtacagaaa atattttcat gaataatagc tactgtgaaa tattgaatca tatatttaaa      1260
     aaaaatttac aaataactaa aaataaaata acatgtgaaa atgccacaca aaggtctttc      1320
     aatgatatgg aaaaatatta tacaaaaaat tcaagtgaca atgtagatct tgattttata      1380
     agaaatctta atggcaacta ccttaatgct gataataaaa ttgaaacata tgatgatgtt      1440
     ctaaatatgt taagtcatat attgtgtttg ctatatttta catccgattc gagagctcat      1500
     gcaacatttg acacatatgc ccacaaacta gcaaaacaac taaattttga aagccgaaaa      1560
     aggaaggaaa tgtctatccc aaaatatttg aactacaaca tgaaagaaat gatttag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page