(data stored in ACNUC9543 zone)

EMBL: AL844507.PE178

AL844507.PE178       Location/Qualifiers
FT   CDS_pept        join(830006..830090,830386..830471,830614..831202,
FT                   831426..831454)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818200"
FT                   /product="14-3-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818200"
FT                   /db_xref="GOA:C0H4V6"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V6"
FT                   /protein_id="CAX64133.1"
FT                   /translation="MATSEELKQLRCDCTYRSKLAEQAERYDEMADAMRTLVEQCVNND
FT                   KDELTVEERNLLSVAYKNAVGARRASWRIISSVEQKEMSKANVHNKNVAATYRKKVEEE
FT                   LNNICQDILNLLTKKLIPNTSESESKVFYYKMKGDYYRYISEFSCDEGKKEASNCAQEA
FT                   YQKATDIAENELPSTHPIRLGLALNYSVFFYEILNQPHQACEMAKRAFDDAITEFDNVS
FT                   EDSYKDSTLIMQLLRDNLTLWTSDLQGDQTEEKSKDEGLE"
     atggcaacat ctgaagaatt aaaacaattg agatgcgatt gtacttatcg ttccaaattg        60
     gctgagcaag ccgaaagata tgatgaaatg gcagatgcta tgagaacttt agttgaacag       120
     tgcgtaaaca atgacaaaga tgagttgacc gttgaagaaa ggaatttatt gtccgttgct       180
     tataagaatg ctgtaggtgc tcgtagagcc tcctggagaa taatctctag tgttgaacag       240
     aaagagatga gcaaagctaa tgttcataat aagaatgttg ctgctaccta tagaaagaaa       300
     gttgaagaag aattaaataa tatttgtcaa gatattttaa atcttcttac gaaaaagtta       360
     attccaaaca cttcagaaag tgaaagtaaa gttttttatt acaagatgaa aggtgattat       420
     taccgttaca tcagtgaatt ttcttgtgat gaaggaaaga aagaagcatc caactgtgct       480
     caagaagctt atcaaaaagc tacggatatt gcagaaaatg aacttccttc cacacatcca       540
     atacgtttag gtttagcttt gaactactca gttttctttt atgaaatatt aaaccaacca       600
     caccaagctt gtgaaatggc aaagagagct ttcgatgatg ccattacaga atttgacaac       660
     gttagcgaag actcttataa agattccact ttaattatgc aactcttaag agataacttg       720
     accttatgga catctgattt gcaaggagat cagaccgaag aaaaatcaaa agacgaagga       780
     ttagaatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page