(data stored in ACNUC9543 zone)

EMBL: AL844507.PE179

AL844507.PE179       Location/Qualifiers
FT   CDS_pept        join(833185..833884,834119..834919,835035..835171,
FT                   835290..835334)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818300"
FT                   /product="dynactin subunit 6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.68:mRNA"
FT                   /db_xref="GOA:Q8IB18"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR027777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB18"
FT                   /protein_id="CAD51191.2"
FT                   /translation="MNKGTIVKLHSLNLDRNINKNVAFNRKGINNYESDLSISSYKTFK
FT                   NSSDNNDIPLYRTCTNDSDHSIKNKDIYGYKKVVSLNEYIFKFKKLTNEKNKNTLDKCN
FT                   IFRRFNTNQNNLINISDSCSESNLSSEGNVSMGVATNMMKKKKIRQNINEGMEDIFCLY
FT                   DKGKHFNYNNYDTIKDITKYKSHIQMEDKPLSCYLNSSFKLMSDNLNCDEKDNTKKTSF
FT                   QIVNDVIWEKRGLITCSNGYILDRDVIKNSEEKKSLKKKVKKYFKHKKSFLQSVKKKRI
FT                   KKYKTVLYNSIHNENKIFVRNPRLSIRDINLYNIKHGKKKNKRIFVFLNGINNIYHSFR
FT                   RKNQNYICNNKNKTCIIMKYNIRNDFINSYEKHLNKKIDNNIFFEIEQNNIKHDIDDNI
FT                   KKPNVEYIKDELNNKESISFYELHKNKNIIIGKRNIIFPSCYMKCDKAKIVIGENNLFE
FT                   DLVTIINNTSTDMYIGSYNIFRSGTYIYNSMKIGDRNCFDYKCNIIKSNIGSHTFIGIN
FT                   MMIDKKWRLRNDHKIVDNVVIYLNSQIIQENMREIISRYNQIK"
     atgaataaag ggacgattgt aaaactacat tccctaaatt tagacaggaa tataaataag        60
     aatgtcgctt ttaatagaaa aggaataaat aattatgaat cagatttatc tatatcatca       120
     tataaaacat ttaaaaattc aagtgataat aatgatatac ctttgtatag aacatgtact       180
     aacgattctg atcattcaat aaaaaataaa gatatttatg gttataaaaa agtagtatct       240
     ttgaatgaat atatatttaa atttaaaaaa ctgacaaatg aaaaaaataa aaatacatta       300
     gacaaatgta atatttttag aagatttaat actaaccaaa ataatcttat aaacatttca       360
     gattcatgta gtgaatccaa tttgagttct gaaggtaatg tgtccatggg tgtagcaaca       420
     aatatgatga aaaaaaagaa aatacgtcaa aatataaatg agggtatgga agatatattt       480
     tgtctttatg ataaaggaaa acattttaat tataataatt atgatactat aaaagatatt       540
     acgaaatata aaagtcatat acaaatggaa gataaacctt tatcttgtta tttaaattcg       600
     tcatttaaat taatgtctga taatttgaat tgtgacgaaa aagataacac aaaaaaaaca       660
     tcctttcaaa ttgttaatga tgttatatgg gaaaaaagag gacttattac atgttcaaat       720
     ggatatatat tagataggga tgttataaaa aatagtgaag aaaaaaaaag tttgaaaaaa       780
     aaggtgaaaa agtatttcaa acataaaaag agttttctgc agagtgtgaa aaaaaagagg       840
     ataaagaaat ataagaccgt tttgtataat tcaatacata atgagaataa gatatttgtg       900
     aggaatccaa gattaagtat tcgagatata aatttatata atataaaaca tgggaaaaaa       960
     aaaaataaaa gaatttttgt ttttttaaat ggtattaata acatatatca ttcatttaga      1020
     agaaaaaatc agaattatat ttgtaataat aaaaataaaa catgtattat tatgaaatat      1080
     aatataagaa atgattttat aaattcctat gaaaaacatt tgaataaaaa aattgataat      1140
     aatatattct tcgaaattga acaaaacaac ataaagcacg atatagatga taatataaag      1200
     aaaccaaatg tcgaatatat aaaggatgaa cttaataata aagaatcgat ttcattttat      1260
     gaattacata aaaataaaaa tataattata ggaaaaagaa atataatatt tccttcttgt      1320
     tatatgaaat gtgataaggc caaaatagtt ataggggaaa ataatttatt tgaagattta      1380
     gttactataa taaataatac gagtacagat atgtatatag gtagttataa tatatttagg      1440
     tctggtacat atatatataa ttcgatgaaa ataggggaca gaaattgttt tgattacaaa      1500
     tgcaatataa ttaaaagcaa tattggatca catacattta ttggtataaa tatgatgata      1560
     gacaaaaaat ggagattacg aaatgatcat aaaattgttg ataatgtagt gatatatttg      1620
     aattcacaaa ttattcaaga aaatatgaga gaaataatat cacgatataa tcaaataaaa      1680
     tga                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page