(data stored in ACNUC9543 zone)

EMBL: AL844507.PE180

AL844507.PE180       Location/Qualifiers
FT   CDS_pept        complement(join(835978..836571,836846..836848))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818400"
FT                   /product="rRNA-processing protein FCF1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.67:mRNA"
FT                   /db_xref="GOA:C0H4V7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V7"
FT                   /protein_id="CAX64134.1"
FT                   /translation="MGKFKKTQKIVKLKRVINPNDKRIIQNNKIKQAEEEKKKKKKESE
FT                   KLKQIEVIDSNLFFNYNENLCPPYNIILDTNFINSSIQYKIDIIKGCSEVLLAKCNIFV
FT                   TDCVIGEMEKLGQRYSLGLKLIKDPRFKRLTCNHKGTYADDCIVNRVTESRCYIIATND
FT                   RDLKIRLRKIPGVPILYAKNFKYKIERLPDNILIS"
     atgggtaagt ttaagaaaac ccagaaaatc gtaaaactaa aacgagttat aaatccaaac        60
     gataaaagga ttatacagaa taataaaata aaacaagcag aagaagagaa aaaaaaaaaa       120
     aaaaaagaga gtgagaagtt gaaacaaata gaagtaatag atagtaactt attttttaat       180
     tataatgaaa atttgtgtcc accatataat ataatcctgg ataccaattt tataaattcc       240
     agtatacaat ataaaattga cataataaaa ggatgttcag aggttttact agccaaatgt       300
     aatatttttg taacagattg tgtaatagga gaaatggaaa agttaggaca aagatattct       360
     ctaggattaa aattaataaa ggatcctcgt tttaaaagat taacttgtaa tcataaaggt       420
     acttatgctg atgattgtat agttaataga gttacagaaa gtcgttgtta tattattgcc       480
     actaacgata gagatcttaa aataagatta agaaaaatac cgggagttcc tattttatat       540
     gcgaaaaatt ttaaatataa aattgaaaga cttcccgata atatacttat ttcgtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page