(data stored in ACNUC9543 zone)

EMBL: AL844507.PE182

AL844507.PE182       Location/Qualifiers
FT   CDS_pept        complement(join(845253..845432,845597..845638,
FT                   845737..845913,846011..846062,846167..846277,
FT                   846385..846463,846594..846661,846785..846839,
FT                   846938..846970,847117..847161,847314..847380))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818600"
FT                   /product="BEM46-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818600"
FT                   /db_xref="GOA:A0A143ZYA4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZYA4"
FT                   /protein_id="CZT62756.1"
FT                   /translation="MRIIKYIFFAFIILALFVCALNTYIYLKQDSFVFSNEFPTVEEKN
FT                   QTLGENYEIVTLTTKDNHKFTCWYIKTKDSENKPIMLYFQGNGGYLEKYMNLFNLIIER
FT                   VDVNIFSCSNRGCGSNIAKPSEEYFYKDAHVYIEYVKTKNPKHLFIFGSSMGAAVAIDT
FT                   ALKQHDHISGLIVQNAFTSLKELSRYSHPFLNYFLFDYDMIIRSKMDNETKIKNITVPT
FT                   LFTLSEMDEKVPTSHTRTLFQLSASTNKQLYLSKGGTHPNILKNDDGSYHKAMKKFIVT
FT                   AISIREKNIQKAVERNPNTPN"
     atgagaataa taaaatatat attttttgca ttcatcatat tagccctctt cgtatgtgcc        60
     ctaaatactt atatatatct caaacaagac agttttgtat tctcaaatga attccctact       120
     gttgaagaga aaaaccaaac actgggagag aactatgaaa tcgttacatt aacaacgaag       180
     gataatcata aattcacatg ttggtatatt aagaccaaag attctgagaa caaaccaatt       240
     atgctttatt ttcaaggaaa cggaggatat ttagaaaaat acatgaactt atttaattta       300
     attatagaga gagttgatgt caacatattt tcatgttcaa acagaggttg cggatctaat       360
     attgctaaac catcagaaga atatttttat aaagatgctc atgtgtatat agaatatgtg       420
     aagacaaaaa atccaaagca tttatttata tttggaagtt caatgggagc cgcagttgca       480
     attgacacgg cattaaaaca gcacgatcat ataagtggat taattgttca gaatgcattt       540
     acaagtttaa aggagctctc gagatattct catccattcc ttaattattt cttatttgat       600
     tatgacatga taataagaag taaaatggat aatgaaacaa aaattaaaaa tattacagta       660
     ccaaccttat ttaccttatc tgaaatggat gaaaaagtac caacaagcca tacaagaaca       720
     ttgtttcagt taagtgcaag taccaacaaa caattatatt tatctaaggg aggaactcat       780
     ccaaacattc tgaaaaatga tgatggttct tatcataaag ctatgaagaa atttattgtt       840
     actgctattt ccataaggga aaaaaatatt caaaaggcag tagaaagaaa tccaaataca       900
     cctaattaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page