(data stored in ACNUC9543 zone)

EMBL: AL844507.PE185

AL844507.PE185       Location/Qualifiers
FT   CDS_pept        860384..862417
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818900"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818900"
FT                   /db_xref="GOA:Q8IB24"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB24"
FT                   /protein_id="CAD51185.1"
FT                   /translation="MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQG
FT                   NRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFT
FT                   VKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFN
FT                   DSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLL
FT                   TIEDGIFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCE
FT                   RAKRTLSSSTQATIEIDSLFEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMD
FT                   KKSVHEVVLVGGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSN
FT                   AVQDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEG
FT                   ERALTKDNNLLGKFHLDGIPPAPRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITIT
FT                   NDKGRLSQDEIDRMVNDAEKYKAEDEENRKRIEARNSLENYCYGVKSSLEDQKIKEKLQ
FT                   PAEIETCMKTITTILEWLEKNQLAGKDEYEAKQKEAESVCAPIMSKIYQDAAGAAGGMP
FT                   GGMPGGMPGGMPGGMNFPGGMPGAGMPGNAPAGSGPTVEEVD"
     atggctagtg caaaaggttc aaaaccaaat ttaccagaat ccaatatcgc tattggaatt        60
     gatttaggta ctacttattc ttgtgttggt gtatggagaa atgaaaatgt agatattatt       120
     gctaatgacc aaggtaatag aacaacccca tcttatgttg ctttcaccga taccgaaaga       180
     ttaattggag atgctgctaa aaaccaagta gctaggaatc cagaaaatac agtatttgat       240
     gctaagagat taattggtag aaaatttaca gaatcatcag tacaaagtga tatgaaacat       300
     tggccattca ctgttaaatc aggtgttgat gagaaaccaa tgattgaagt tacctatcaa       360
     ggagaaaaga aattattcca tccagaagaa atttcttcta tggtattaca aaaaatgaaa       420
     gaaaatgctg aagcattttt aggaaaatct ataaagaatg ctgtcattac cgttccagct       480
     tattttaacg attcacaaag acaagctact aaagatgctg gtacaattgc aggattaaat       540
     gttatgagaa ttattaatga acctactgca gctgctattg catatggttt acacaaaaaa       600
     ggaaaaggtg aaaagaacat tttaattttc gacttaggag gaggtacatt tgatgtatca       660
     ttattaacta ttgaagatgg tatttttgaa gtaaaagcta ctgctggtga tactcattta       720
     ggtggtgaag atttcgataa cagattagta aatttctgtg ttgaagattt caaaagaaaa       780
     aacagaggta aagatttatc aaaaaatagt agagccttaa gaagattaag aacacaatgt       840
     gaaagagcaa aacgtacttt atcatcatct acacaagcta caattgaaat agattcctta       900
     tttgaaggta ttgattacag tgttactgta agtagagcaa gatttgaaga attatgtatc       960
     gactatttcc gtgatacttt aattccagta gaaaaagttt taaaagatgc tatgatggat      1020
     aaaaaaagtg tacatgaagt tgttttagtt ggtggttcta caagaattcc aaaaatccaa      1080
     actttaataa aagaattctt taatggtaaa gaagcatgca gatcaattaa cccagatgaa      1140
     gctgttgcat atggtgcagc tgtacaagca gccattttat ctggtgacca atcaaatgct      1200
     gtccaagatt tattattatt agatgtttgc tccttatcat taggtttaga aactgctggt      1260
     ggtgttatga ccaaattaat tgaaagaaac acaaccatac ctgctaaaaa gagtcaaatc      1320
     tttactactt atgctgataa ccaaccaggt gtcttaattc aagtatatga aggtgaaaga      1380
     gccttaacca aagataacaa tttattagga aaatttcact tagatggtat tccacctgca      1440
     ccaagaaagg taccacaaat cgaagttaca ttcgatatcg atgctaacgg tatcttaaac      1500
     gttacggctg tagaaaaatc cactggtaaa caaaaccata ttacaattac caacgacaaa      1560
     ggaagattat ctcaagatga aattgatcgt atggttaatg atgctgaaaa atacaaagca      1620
     gaagatgaag aaaacagaaa aagaatcgaa gcaagaaaca gccttgaaaa ttactgctat      1680
     ggagttaaaa gctcattaga agaccaaaaa attaaagaaa aattacaacc agctgaaatt      1740
     gaaacatgta tgaaaactat tacaaccata cttgaatggt tagaaaaaaa ccaacttgct      1800
     ggaaaagatg aatatgaagc caaacaaaaa gaagcagaat cggtttgtgc tccaattatg      1860
     tctaaaatct atcaagatgc tgctggtgca gccggtggta tgccaggagg tatgcccggt      1920
     ggaatgcccg gtggaatgcc aggtggtatg aatttcccag gaggtatgcc cggagcagga      1980
     atgccaggaa atgccccagc tggaagtgga ccaacagttg aagaagttga ttaa            2034
//

If you have problems or comments...

PBIL Back to PBIL home page