(data stored in ACNUC9543 zone)

EMBL: AL844507.PE186

AL844507.PE186       Location/Qualifiers
FT   CDS_pept        complement(join(863505..864138,864312..866588,
FT                   866707..866794,866925..867532,867803..868137))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.64:mRNA"
FT                   /db_xref="GOA:Q8IB25"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR027075"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB25"
FT                   /protein_id="CAD51184.1"
FT                   /translation="MLIEIVPLYSNSFYSTLLIIKDFNVLKENERISLKDNLNEQNENQ
FT                   SSDKNVSISSVENINVENYNCEELYKYDYVNNKRDFYNDRKDNNIYILMNCGWDDKFCL
FT                   EDIKNVIRVCEVIDLIIITNHSLNYIGSLPVVFMELLKRKKKVPIICHEYIKSYSKYIL
FT                   LSYLKCNYNCEYFKNFKENEYIELINNLYENIIILEYMEHYVFKKVICKKTNIEYILPL
FT                   YLINNGDNIGSSAVILKLFNNKILYSINCNLEDYSFIEKSHVIKESNIFTYISNFHYSN
FT                   KNSTKMMDMKNILNTINKTIKKMGCVLLPVDIDSIFIDLLFHINALLEVCSQRYMLLFL
FT                   CPYGENFIRLLFTSLTYMNVHIKNNFHKNRINLFKIKNLICLKNYNDFKKYEDAYYILF
FT                   SFPSTLNNESVKRILSTFLKKEENVILFTKEQTGQENMSSNLWKHVSCNEQNKEKEKTS
FT                   HFNFSYVQNIKYDDKMLYDIYLKEKENIQNEILQKKGEEKIKKKIKRSVKKNKPMNFIF
FT                   ESHEEMLYLKKENNFVDKKKEIKCKRDFWEDNKDKVVKSEKNDDDKDDDKDDDKDDDKD
FT                   DDKDDDKDDNNDDNNDDNNDDNNDDNNDDNNDDNYNDDDEIYDESSNSSNSNDYEDENY
FT                   FLKGNKKKKYLYRINTFNEGDTSDDGDNQINDINKLSDNNESEDDDFNHLIKSKDDNRK
FT                   KKNKQKIYRDFPYQNVNNHNDDANSSESIIDDEEEYYKKEVVEDVKDGSLKNQNKKKVR
FT                   IKMEPMNDDNDNNYVEEEEYKIAGVHEKKLRSNIKKELYFYDNMEQNYNQNEDDYNDDD
FT                   YNDDNYNDDDYNDDDDNDDNDDDNDDDNNNEEEKHEYVKKISGDKNKKRNKNRSKTNYH
FT                   YDNYYNMKENLDESENMSDYYNINKGKHILNKGSTLNNTFDTDYKHQNNRHMINKKMAW
FT                   KQKLFVYLKKIPTQEKQQHVSIPIECLIELYNLENYINQNTLKTIIQFMKPKHFVLLPT
FT                   YNSYYSFHLEMLLHSSISTYDYTKIYSFYIPNFYYTDNHNEVFFKRYFSLNNKSIDSVH
FT                   IPLNMNYENIYIRSIYNLISSKNCQDDKFQIYKIKATISDVSVKNKKDVYENYRRRKRF
FT                   INEHSTFWSEYNDVNYILKLGDDEKYDEEKEDKEENIPSEEKEKENEKSNERRFLNFYI
FT                   DDDKENEEDESDEDSIDFSDSCLSSDRQECILSKDMNEENNNKIEGNLYIGDVNMQNLC
FT                   TNIHSVFNRSLNFVDENQIIINGNTCVKKEVQTKVQNQNQENYEDKENFKKQDHNSNSN
FT                   FIWRIESSLDPTFYFVRNILKDMYNNVSI"
     atgcttatag aaattgtacc attatatagt aatagctttt atagtactct gttgataata        60
     aaagatttta atgtactaaa agaaaatgaa cgaatatctt taaaggataa tttaaatgaa       120
     cagaatgaaa accaatcatc agataaaaat gtttcaatat cgagtgtaga gaatataaat       180
     gttgaaaatt ataattgtga agagttatat aaatatgatt atgtaaataa taagagagat       240
     ttttataatg acagaaagga taataatatt tacattttga tgaactgtgg atgggatgat       300
     aaattttgtc ttgaagacat aaaaaatgtt ataagggtat gtgaagttat agatttgata       360
     ataataacga atcatagttt aaactacatt ggtagcttac cagtagtatt tatggaatta       420
     ctaaaaagaa aaaaaaaggt acctatcatt tgtcatgaat atattaaatc ttatagtaaa       480
     tatattttat taagttattt gaaatgtaat tacaattgtg aatattttaa aaatttcaag       540
     gaaaatgaat atatagaatt aattaataat ttatatgaaa atattataat cttagaatat       600
     atggaacatt atgtttttaa aaaagtaata tgtaagaaaa caaatattga atatatatta       660
     ccattatatt tgataaataa tggagataat ataggttctt cagcagttat tttaaaatta       720
     tttaacaata aaatattata ttccataaat tgtaatttag aagattattc ttttatagaa       780
     aaatcacatg ttataaaaga atccaatatt tttacatata ttagtaactt tcattattca       840
     aataaaaatt ctactaagat gatggatatg aaaaatattt tgaatactat aaataaaact       900
     ataaaaaaaa tgggatgtgt cctcttacct gttgatatag atagcatatt tattgaccta       960
     ttgtttcata ttaatgcctt attagaagta tgttcacaaa gatatatgct cttattttta      1020
     tgtccatatg gagaaaattt cataagactt ctgtttacct ccctaaccta catgaacgtg      1080
     catataaaaa acaacttcca taaaaatcga attaatttat ttaaaattaa aaatttaata      1140
     tgtttgaaga attacaacga ttttaaaaaa tatgaagatg catattacat cttgttttcc      1200
     tttccatcaa ctttgaacaa tgaatccgtg aaaaggattc tatccacatt tttgaagaaa      1260
     gaagaaaacg ttattttatt tacaaaagaa caaacaggac aagaaaatat gtcaagcaat      1320
     ttatggaaac atgttagttg caatgagcaa aataaagaaa aagagaaaac tagccatttt      1380
     aatttttcat atgtgcaaaa tataaaatat gatgataaaa tgttgtatga tatttatttg      1440
     aaagagaagg aaaatattca gaatgaaatt ttacaaaaga aaggagaaga aaagataaag      1500
     aaaaaaatca aaaggagtgt taaaaaaaat aaaccgatga attttatttt tgagtctcat      1560
     gaagaaatgc tttacttgaa aaaggaaaat aattttgttg ataaaaaaaa agaaataaaa      1620
     tgtaaaaggg atttttggga ggacaataag gataaggttg taaaaagtga aaagaatgat      1680
     gatgataagg atgatgataa ggatgatgat aaagatgatg ataaggatga tgataaagat      1740
     gatgataaag atgataataa tgatgacaat aatgatgaca ataatgatga caataatgat      1800
     gacaataatg atgataataa tgatgataat tataatgatg atgatgaaat ttacgacgaa      1860
     tcttctaata gtagtaattc caacgattat gaagatgaaa attatttttt aaaaggaaat      1920
     aagaaaaaaa aatatttata cagaataaac acgttcaatg aaggagatac aagtgatgat      1980
     ggtgataacc aaattaatga tataaacaaa ttatctgata ataatgaaag tgaagatgat      2040
     gatttcaatc atctaataaa aagtaaagat gacaatagaa aaaaaaagaa caagcaaaaa      2100
     atatacagag attttcctta tcaaaatgtt aataaccata atgatgatgc aaattcttcc      2160
     gagtcaatta ttgatgatga agaagagtat tataaaaaag aagttgtaga agatgtaaag      2220
     gatggatctt tgaaaaatca aaataaaaaa aaggtgagaa taaaaatgga acccatgaat      2280
     gatgataatg acaataatta tgttgaggag gaagagtata aaatagcagg tgtgcatgaa      2340
     aagaaactaa ggagtaatat aaaaaaagaa ttatattttt atgataatat ggagcaaaat      2400
     tataatcaaa atgaagatga ttataatgat gatgattata atgatgataa ttataatgat      2460
     gatgattata atgatgatga tgataatgat gataatgatg atgataatga tgatgataat      2520
     aataatgagg aggaaaaaca tgaatacgtt aaaaaaattt caggtgataa aaataaaaaa      2580
     agaaataaaa ataggagtaa aacaaattat cattatgata attattataa catgaaagaa      2640
     aatttagatg aatcagaaaa catgtcagat tattataata taaataaagg aaaacatata      2700
     ttaaataaag gtagcacatt aaataataca tttgatacag attataaaca tcaaaacaat      2760
     agacatatga taaataaaaa aatggcatgg aaacaaaaat tatttgtata cttaaaaaaa      2820
     ataccaactc aagaaaaaca acaacatgta tccataccta ttgaatgctt aattgaatta      2880
     tataatctag aaaattatat taatcaaaat actttaaaaa caataataca atttatgaaa      2940
     ccgaaacatt ttgttttact tcccacatat aatagttact actcgtttca tttagaaatg      3000
     ttattacatt ctagtataag tacatatgat tatacaaaaa tttattcttt ctatattcct      3060
     aatttttatt atactgataa tcataacgaa gtttttttta aacgttattt ttccttaaac      3120
     aacaaatcaa ttgattcagt tcatattcct ttaaatatga attatgaaaa tatatatata      3180
     agaagtatat ataatttgat tagtagtaaa aattgtcagg atgataagtt tcaaatatat      3240
     aaaattaaag ccacaatatc agatgtatca gtaaaaaata aaaaagatgt ctacgaaaat      3300
     tataggagga ggaaaagatt tattaatgag cacagcactt tttggagcga atacaatgac      3360
     gtgaattaca tactaaaatt aggagatgat gaaaaatatg acgaagagaa agaggacaag      3420
     gaggaaaata ttcctagtga agaaaaagaa aaagaaaatg aaaaaagtaa tgaaagaagg      3480
     tttttaaatt tttatattga tgatgataaa gaaaatgaag aggatgaatc tgatgaagat      3540
     tctattgatt tttcggattc atgtttatca tcagatagac aagaatgtat attatcaaaa      3600
     gatatgaatg aagaaaataa taataaaata gagggaaatt tatatattgg ggatgtaaat      3660
     atgcaaaacc tatgtacaaa tatacattcc gtttttaata gatcattaaa ttttgttgat      3720
     gaaaatcaga ttataattaa tggaaataca tgtgtcaaaa aagaggtaca gacaaaagtg      3780
     caaaatcaaa atcaagaaaa ttatgaagat aaagaaaatt ttaaaaagca agaccataat      3840
     agcaatagta attttatatg gcgtattgaa agttccttag atcctacatt ttatttcgta      3900
     cgaaatatat taaaggatat gtacaataat gtatccatat aa                         3942
//

If you have problems or comments...

PBIL Back to PBIL home page