(data stored in ACNUC9543 zone)

EMBL: AL844507.PE187

AL844507.PE187       Location/Qualifiers
FT   CDS_pept        join(869562..870420,870546..870574)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819100"
FT                   /product="BRIX domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0053:mRNA"
FT                   /db_xref="GOA:Q8IB26"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB26"
FT                   /protein_id="CAD51183.2"
FT                   /translation="MVTKIKGKFKKGASNNKEAGIRNKKNKKKNNNRKSDINENEESLI
FT                   KKTNIMVIKKKGMNSEIKALSRDLVDLFNPYCAVFYIRKLKNLQELNKKLKELSYKYTV
FT                   CFYIQNNKLLYSITSNYTKLSLTFSVQSYTTSTLIKSLYLKNVYCNFNKLKPLLILKNF
FT                   NNTSNTEMSNYLIITQNILKNLYPSVNLNEDFMNKPRRVLLYCYNDNDQTIYFRQYATN
FT                   LKKISFKKILKEAYNEDMSGYNDVFNYLSSKLDGKHFNTDTISQMLEIGPRVSYKIFKI
FT                   TDQDKVIYSVTDKK"
     atggtgacaa aaataaaagg gaaatttaaa aaaggggcat caaataacaa agaagcagga        60
     ataagaaata aaaaaaataa aaaaaaaaat aataatagaa aaagtgacat taatgaaaat       120
     gaagaaagtt taattaagaa aactaatata atggtaataa aaaaaaaagg aatgaattca       180
     gaaattaaag cattaagcag agatttggta gatttgttta atccatattg tgcagttttc       240
     tatataagaa aattaaaaaa tttacaagaa ttaaataaga aattaaaaga attaagttat       300
     aaatatacag tttgcttcta tatacaaaat aataaattgt tatatagtat tactagtaat       360
     tatacaaaat tatctttaac cttttctgtt caaagttata ccacgtctac tttaatcaaa       420
     tctttatatt tgaaaaatgt atattgtaat tttaataaat taaaaccatt actcatttta       480
     aaaaatttta ataacacttc aaatacagaa atgtcaaatt atcttattat tacacaaaat       540
     attcttaaaa atctctatcc aagtgttaat ttgaatgagg attttatgaa caaacctaga       600
     agagttttat tatattgtta caatgataat gatcaaacca tatactttcg tcaatatgca       660
     accaacttaa aaaaaatatc gtttaaaaaa atattgaagg aggcatataa tgaagacatg       720
     agtggatata atgatgtatt taattattta tcatccaaat tggatggtaa acatttcaac       780
     actgatacaa tctctcaaat gttagaaatt ggtccacgtg ttagttacaa aatttttaaa       840
     attacagatc aggataaagt catatactcc gttaccgata aaaagtaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page