(data stored in ACNUC9543 zone)

EMBL: AL844507.PE188

AL844507.PE188       Location/Qualifiers
FT   CDS_pept        871410..873440
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819200"
FT                   /product="perforin-like protein 5"
FT                   /protein_id="VWP74460.1"
FT                   /translation="MKIKKSCIFFGYAFALFCTVCCFSKKDIFNPKLYTSDVEYKEREY
FT                   FLKYLGMSYDIIKGNPWGDPIYVIDLGYRRNVLKKRKLNSDNNIKDDIVKFKVGEASKI
FT                   KCIDTIKENVIDNLCDINKEYERSYSVSSINDDIHPFNDSNYYKMLVKRINRGDSIIIE
FT                   KKLCSKYFSFINDINKNDLDTFFLTTLNELGDNYQNIKDDTYKCSLQYYKMNNMNKYSE
FT                   NCLKTITPWISFFNMYGTHVISGVYYGGKIIHNLYFENNNLKKKEYKIRMYKSRLNPFS
FT                   TINSNLYFGSSLSKEKIIYIRERNLIMDGGVHINPYNINEVNMENKKKNIYVNNVEKNL
FT                   YDQKKKYRNYYNFYELKDDVRKRNYYNSWKDTIEWEQAKPVKLNLVPLSEFINSEEGKS
FT                   AYYMALEFYSNLSYSNYNPYLYVLNKSEKDIYIMDIKRNWAQYIDKNINFNVTPKCKNG
FT                   DKILSGFILTNKKKSYEDNHIIHMCPSNTVCSSGINIESDKNFEFSWILCSKENRSEIH
FT                   QILTKNTFQGNGKASCPYNMKIGFGFSLTFQKSINTNIKIEPCESNKKECKRTNLASSS
FT                   QTYFWINCLPTNKNLLLQTLESKTYSEKKYLNDHFVFSLKCSEGKYIIAGFAIDYIPSG
FT                   VNDYLVCPVGSNKCDLKIHVVEKNIGEVHIPIMYIVCSSIS"
     atgaaaataa aaaaaagttg catctttttt ggttatgctt ttgcattatt ttgtacagtg        60
     tgctgttttt caaagaaaga tatatttaac cctaaattat acacttccga tgttgaatat       120
     aaagaaagag aatacttttt aaaatacctg gggatgtcgt atgatattat taagggtaat       180
     ccttggggag atccaattta tgtgatagat ttaggataca gacgaaatgt tcttaagaag       240
     agaaaactaa attcggataa taatataaaa gatgatattg ttaaatttaa agttggagaa       300
     gcttctaaaa taaaatgtat tgatactata aaagaaaatg tgatagataa cttatgtgat       360
     ataaataaag agtacgagag aagttattca gtttcttcca ttaatgatga tatccatcct       420
     tttaatgatt ctaattatta taaaatgtta gtaaaaagaa taaatagagg tgattccata       480
     attatagaga aaaagttatg ttcaaaatat ttttctttta taaatgatat aaataaaaat       540
     gatttggata cgtttttttt aacaacactg aatgaattag gagataatta tcaaaacata       600
     aaagatgata catataaatg tagtttacaa tattataaga tgaataatat gaataaatat       660
     agtgaaaatt gtttaaaaac tataactcca tggatatctt tttttaatat gtatggaaca       720
     catgtgatat caggagttta ttatggaggt aagataatac ataatttata ctttgaaaat       780
     aataatttga aaaaaaaaga atataaaata aggatgtata agagcagatt gaatcctttt       840
     agtactatta attccaactt atattttggt tcttccctat caaaggaaaa aattatttat       900
     ataagggaaa ggaatttaat catggatggg ggggtacaca ttaatcccta caatattaat       960
     gaggtaaata tggaaaataa aaaaaaaaat atatatgtta ataatgttga aaaaaatttg      1020
     tatgatcaga agaaaaagta tagaaattat tataattttt atgaattaaa agatgatgta      1080
     aggaaacgta attattataa tagttggaaa gataccattg aatgggaaca agccaaacca      1140
     gtcaaattaa atttagtacc cttatctgaa tttataaatt cagaagaagg aaaatctgct      1200
     tattacatgg ctcttgaatt ttattccaat ttgagttatt ctaattataa tccttattta      1260
     tatgtattaa ataaaagtga aaaggatata tatataatgg atataaaaag aaattgggca      1320
     caatatattg acaaaaatat aaatttcaat gtaacgccta aatgtaaaaa cggcgataaa      1380
     atattaagtg gttttattct tacaaataaa aagaaatcat atgaagataa tcatattata      1440
     cacatgtgtc catcaaacac cgtgtgttct agtggtataa atattgaatc agataaaaat      1500
     tttgaattta gttggatttt atgtagtaag gaaaatagaa gtgagataca tcaaatatta      1560
     accaaaaata cgtttcaagg aaatggaaag gcttcatgtc cttataatat gaaaataggt      1620
     tttggatttt cattaacatt tcagaaatct ataaatacga atataaaaat tgaaccttgt      1680
     gaaagtaata aaaaagaatg taaaagaaca aatttggcta gttcttctca aacatatttc      1740
     tggattaatt gtttacctac caacaaaaat ttattattac aaaccttgga atcaaaaaca      1800
     tatagtgaga aaaaatattt aaatgatcat tttgtgttta gcttaaaatg ttctgaaggg      1860
     aaatatataa ttgcaggttt cgcaattgat tatattcctt cgggtgttaa tgattattta      1920
     gtatgtcccg taggaagtaa taaatgtgat ttaaagattc atgttgtgga gaaaaatata      1980
     ggtgaagtac atatacctat tatgtatatt gtgtgttctt ctatttcata a               2031
//

If you have problems or comments...

PBIL Back to PBIL home page