(data stored in ACNUC9543 zone)

EMBL: AL844507.PE190

AL844507.PE190       Location/Qualifiers
FT   CDS_pept        878495..880459
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819400"
FT                   /product="perforin-like protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0050:mRNA"
FT                   /db_xref="GOA:Q8IB29"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB29"
FT                   /protein_id="CAD51180.1"
FT                   /translation="MMIFSNYLFNILIVCYLFIYIGSFSICHDIKTDEKTNEIFSKYLG
FT                   KGYDILFGYPLPNNELIDDPGFKEVIIDTQLSIDNISNYICKKEEYVDVIEDINDIGYL
FT                   GMQKINIDDLDNRIKPFSASMPYKSYFADLEIKKKKYALAQNMCVLNYATYDLKESGNN
FT                   INKDFVLDIEKLPILTKNQMKLCTKVLYMNNNLHCSEGIKSWMKFFEKYGTHVVLSAHF
FT                   GGMSFNTMEITKRKIEEIKIYKYKYSLWNNPYLNIFKSGSLFQDLSINVDGHKENKKNN
FT                   SNNNINIDEKKKNDAYIKNDVLIEQYRDNINLEIRGGNNFDEKWRNLTYLVWKNSIYSN
FT                   IVPIHLDLYSLNTFMPIEKKESYDMALLFYNNLYGIDNENFYLSQDITDVLSEGKQITG
FT                   SNKGSLILSCPVGYIKSTGLIFVYDSSEKLKTNKSKDPKIKIYPCTNKGQYDIACSYIT
FT                   KKKNIITFGWIYCVKHNFIKFETLYQNNDNIISKDGKTFMSLTCTEGNTIAFGFKMKLK
FT                   KLEKLEKLKIKPCTIGDDQCTINNIKRNSDYLLWGFCVPSSFRSLSSLQLTYIHDDTIQ
FT                   NDIRGACSDIYINKYDNIFLGFTFSFDNKFEQVKTEPCESQSKYCFHIIPKKKKKMYYV
FT                   GMFLLCRFDGNTNRKFTYK"
     atgatgatat tttcaaatta tttatttaac atactaatcg tatgttactt gtttatctat        60
     ataggttcgt tttctatttg tcatgatata aaaactgacg aaaaaaccaa tgaaatattc       120
     agcaaatatt tgggaaaagg ctatgatatt ttgtttggtt atccattacc taataatgaa       180
     cttattgacg atccaggatt taaagaagtt attatagaca cacaattatc aattgacaac       240
     atatcaaatt atatttgtaa aaaggaagaa tatgtagatg ttatagaaga cataaatgat       300
     ataggttatc taggaatgca gaaaataaat attgatgatt tggataatcg tataaaacca       360
     ttttcagcgt ctatgccata taaaagctat tttgcagact tagaaattaa gaagaaaaaa       420
     tatgcactag ctcaaaatat gtgtgtatta aattatgcta catatgattt aaaagaatcc       480
     gggaacaata taaataagga tttcgtatta gacattgaaa aattacctat tttaacaaaa       540
     aaccaaatga agttatgtac caaagtatta tatatgaata ataatctgca ttgttcagaa       600
     ggtataaaaa gctggatgaa attttttgaa aaatatggaa ctcatgtagt attatctgcc       660
     cattttggtg gtatgtcatt taataccatg gaaattacga aaagaaaaat tgaagaaata       720
     aaaatatata agtataaata ctctctttgg aataacccat atttaaatat ctttaaatct       780
     ggatcgttat ttcaagatct tagcattaat gtagatggtc acaaagaaaa taaaaaaaat       840
     aatagtaata ataatattaa tatagatgag aagaagaaaa atgatgctta tataaaaaat       900
     gatgtgttaa tagaacaata tagggacaat attaatctag aaattcgggg aggaaataat       960
     tttgatgaaa agtggagaaa tttaacatat ttagtttgga aaaattctat ttattctaat      1020
     atagttccta tacatcttga cttgtattca ttgaatacat tcatgcctat agaaaaaaag      1080
     gaatcatatg atatggcttt attattttat aataatttgt acggaataga taatgaaaac      1140
     ttttatcttt ctcaagacat aacagatgta ttatccgaag gaaaacagat aactggttca      1200
     aataaaggat ctttgatttt aagttgtcct gttggatata taaaaagcac tggtctgatt      1260
     ttcgtttacg acagttctga gaaattaaaa actaataaaa gtaaggaccc caaaataaaa      1320
     atatatccat gtactaataa agggcaatat gatattgctt gctcatatat aacaaagaag      1380
     aaaaatatta taacattcgg atggatatac tgtgtaaagc ataattttat taaatttgaa      1440
     acgctttatc aaaataatga taatattata tctaaggacg gtaaaacatt tatgagcctt      1500
     acctgcaccg aaggaaatac gatagctttc ggttttaaaa tgaaattaaa aaagttggaa      1560
     aaattagaaa agttaaaaat aaaaccatgt actataggag atgatcagtg tactattaat      1620
     aatatcaaaa gaaattccga ttatttatta tggggctttt gtgtaccttc atcttttcgt      1680
     agtctttctt ctttacaatt aacctatatt catgatgata ctatacaaaa tgatatacga      1740
     ggagcttgtt cagatatata tattaataaa tacgataata tttttctagg ttttactttt      1800
     tccttcgata ataaatttga acaagtaaaa acggaacctt gtgaaagcca atccaaatat      1860
     tgttttcata taataccaaa aaagaaaaaa aaaatgtatt atgttgggat gtttttatta      1920
     tgcagatttg atgggaacac gaatagaaag tttacatata aataa                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page