(data stored in ACNUC9543 zone)

EMBL: AL844507.PE191

AL844507.PE191       Location/Qualifiers
FT   CDS_pept        join(881590..881685,881814..881873,882002..882058,
FT                   882161..882214,882323..882376,882561..882619,
FT                   882762..882879,883026..883247,883343..883409,
FT                   883557..883676,883930..884023,884136..884190,
FT                   884286..884390)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819500"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.63:mRNA"
FT                   /db_xref="GOA:C0H4W0"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W0"
FT                   /protein_id="CAX64138.1"
FT                   /translation="MYVLFNDHLKEEGEQNVKLQICNGKNNSSSENENTLSSKYFRKEN
FT                   RRFKQNINILDKHIILADNFGDVPEENFELPDNKQNELEILRKRKNIEPTGIVIACCLG
FT                   TDFRFSALIKDFKTHNVNSDLIKIKKVYSEVIFCSAFEQKKIFFLFRFGCIVLWDFNIK
FT                   EKEILFMYLKDYLSEAHTENNNELDSMFYIMNVQNELSDNKSVKAADSPSFKIKNDIIY
FT                   IYTKDIFEKLSYSYAFAQSVKLSYFENVVDVTIEKTKSIPECLARTGKIQLKKNDISKK
FT                   IGELFVNRFYINMNTDMLDTPEIFWDHDDFTDTYEYFGKYLDISKRVEILNHRLDIIKD
FT                   LYDMLQNELTIQHGYKLEWIVIYLICIEVLIDIVWTIIIKGVFKWG"
     atgtatgtac tatttaatga tcatttaaag gaagaaggtg aacaaaatgt taagttacaa        60
     atttgtaatg gaaaaaataa ttcatcttcg gaaaatgaaa atacattgtc atcgaaatac       120
     tttaggaagg aaaatagaag atttaaacag aacataaata tattggataa acatataatt       180
     ttagcagata actttggaga tgttccggaa gagaattttg aattacctga taataaacaa       240
     aatgagttgg aaatattaag aaaaaggaaa aatattgaac cgactggcat tgtgattgct       300
     tgttgtctag ggaccgattt ccgtttttca gcattaataa aagattttaa aacacataac       360
     gtaaatagtg accttataaa aatcaaaaag gtatatagcg aagtaatatt ttgctcagcg       420
     tttgaacaga aaaagatttt ttttttgttt cgttttggat gcattgttct atgggatttc       480
     aatataaaag aaaaggagat attgtttatg tatttaaaag attatttaag tgaagcgcat       540
     acagaaaata ataatgagct tgatagtatg ttttatataa tgaatgtaca aaacgaatta       600
     agtgacaata aaagtgtgaa agcggctgat tcaccatcct ttaaaataaa aaacgatata       660
     atatatatat acacaaagga tatctttgaa aagttgagtt attcttatgc ttttgcccaa       720
     agtgtaaaat tgtcttattt tgaaaatgtt gttgatgtta ctatagaaaa aacaaaaagc       780
     ataccagagt gcttggcacg aacaggaaaa atccagctta aaaaaaatga tattagcaaa       840
     aaaataggag aattatttgt aaacaggttt tatataaata tgaatacaga tatgttggat       900
     acaccagaaa tattttggga tcatgatgac tttaccgata cgtatgaata ttttggaaaa       960
     tatttggaca tatcaaagag ggttgaaata ttaaaccata gattggatat catcaaggat      1020
     ctgtatgaca tgttgcagaa tgagttaaca atacaacatg gttacaaact tgagtggatt      1080
     gttatttatt taatatgcat agaagtacta atagacattg tatggacaat tattattaag      1140
     ggtgttttta aatggggtta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page