(data stored in ACNUC9543 zone)

EMBL: AL844507.PE193

AL844507.PE193       Location/Qualifiers
FT   CDS_pept        complement(888126..890471)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819700"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.61:mRNA"
FT                   /db_xref="GOA:C0H4W1"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W1"
FT                   /protein_id="CAX64139.1"
FT                   /translation="MKNFCLTKGKVKNVINYAILLCIYIIIWILLTLYCLFNKLKSYII
FT                   SLQLICKYIIIQIVKCNNVNDLNLNNLKNKSNKNFQFLKNKIYNIFYNCLSRKNEKHDD
FT                   IFKIYKNINKVPKHIYIVFKISDLIILNSEKLINHIVNILIYLYEFKIEHVTIYVSDHF
FT                   FDYIFYYDLFKYLYKKNFYMKCVIKENNISNNNNNFISSNDKCNKKNYFSCNYNNHIYD
FT                   TNKSFQCYHHTDEFVITKFSLPQNIPPQENSSPELFYRKRKNKEKMNSNKNKKGNYKDD
FT                   HMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMN
FT                   SYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYK
FT                   DDHMNNYKDDHMNNYKDDHMNNYKDDHMNNYKDDHMNNYKDNHMNSYKHNHMNNYHSTH
FT                   FSYDKFSLHLKFLNKDKSHKHLIKIAKEKGNMLSEGVLINDMLNFSYTNIESVIEKIYQ
FT                   LDKNYNNKYTDNIKNIKKTGNILFYVFYFLQQTKHIFLLKMNCLYYMLSKNILLKVLSK
FT                   DNLRNYSYNNIYRNVYYIWNILKSPFSFHSKYIEKEINNKEKVIAKTNESKNITISIIH
FT                   KLFNNVITQDEKCIKNIKELINKNIPMYVKPIYQDLFNHNVHTLFNPTSVDIVISLRLS
FT                   LSDYLIEIFHLFYHKKYNIKKLNPFHFFMQYISSFLFLYKVVHPFEQNGIQPWVLSNSE
FT                   LYEFYGYHINSLKKSILYYNRSTQRCGH"
     atgaagaatt tttgtttaac taaaggaaaa gtaaagaatg taattaacta cgcgatttta        60
     ttatgtatat atataataat atggatacta ctaactttat attgtttgtt taataagtta       120
     aagagttata ttataagctt acaactaata tgtaaatata ttattataca aattgtcaaa       180
     tgtaataatg tgaacgattt aaatttgaat aatttaaaaa ataaaagtaa taaaaatttt       240
     caatttttaa agaataaaat atataatata ttttataatt gtctttctag aaaaaatgaa       300
     aagcatgatg atatttttaa aatatataag aatattaaca aggtacctaa acacatatat       360
     atagtattta aaataagtga tttaataata ttgaacagtg aaaaacttat aaatcatatc       420
     gttaatatat taatatattt gtatgaattt aaaattgagc atgtaaccat atatgtatct       480
     gatcattttt tcgattatat attttactat gatttgttta aatacttata taaaaagaat       540
     ttctacatga aatgtgttat aaaagagaat aacataagta acaataataa taactttatt       600
     agtagtaatg ataaatgtaa taagaaaaat tatttttctt gtaattataa taaccatatt       660
     tatgatacaa ataaatcgtt tcaatgttat catcatacag atgaatttgt cataacaaaa       720
     ttttctctcc cgcaaaatat tcctcctcaa gagaattcga gtccagaatt attttaccga       780
     aaaaggaaaa acaaagaaaa aatgaatagt aataagaata aaaaaggtaa ttacaaggat       840
     gatcatatga atagttataa ggatgatcat atgaatagtt ataaggatga tcatatgaat       900
     agttataagg atgatcatat gaatagttat aaggatgatc atatgaatag ttataaggat       960
     gatcatatga atagttataa ggatgatcat atgaatagtt ataaggatga tcatatgaat      1020
     agttataagg atgatcatat gaatagttat aaggatgatc atatgaatag ttataaggat      1080
     gatcatatga atagttataa ggatgatcat atgaatagtt ataaggatga tcatatgaat      1140
     agttataagg atgatcatat gaatagttat aaggatgatc atatgaatag ttacaaggat      1200
     gatcatatga ataattacaa ggatgatcat atgaacaatt acaaggatga tcatatgaat      1260
     aattacaagg atgatcatat gaacaattac aaggatgatc atatgaacaa ttacaaggat      1320
     aatcatatga atagttataa gcataatcat atgaataatt atcatagcac acattttagt      1380
     tatgataaat tttcccttca tctcaaattt ttaaacaaag ataaatcaca caagcacttg      1440
     atcaaaatcg caaaggaaaa aggaaatatg ttatcagaag gtgtattaat aaatgacatg      1500
     ttaaattttt catatacaaa catagaatca gtgatagaaa aaatatatca attagataaa      1560
     aattataata ataaatacac agataatatt aaaaatatta aaaaaactgg gaacatactt      1620
     ttttatgtat tttatttttt acaacaaaca aaacatatat tcttattaaa aatgaattgt      1680
     ttatattata tgctatcaaa aaatatattg ttaaaagtgt tatcaaagga taatttaaga      1740
     aattattcat ataataatat atacagaaat gtatattata tatggaatat attaaaatca      1800
     cctttttctt ttcattcaaa atatatagaa aaagaaataa acaataaaga aaaagtaata      1860
     gcaaaaacta atgaaagtaa aaatataact ataagtatta tacataaatt attcaataat      1920
     gttattacac aagatgaaaa atgtataaag aatattaaag aattaataaa taaaaatatc      1980
     cctatgtatg ttaaaccaat ataccaagat ttatttaacc ataatgttca tacactattc      2040
     aatcctacaa gtgttgatat agtcatatct ttaagactta gtttatctga ctatcttatt      2100
     gaaatatttc atttgtttta tcacaaaaaa tataatataa aaaaattaaa ccctttccat      2160
     ttttttatgc aatatattag ttcctttcta tttttatata aagtcgtaca tccttttgaa      2220
     caaaatggaa tacaaccatg ggttctatcc aattctgaat tatatgaatt ttatggttat      2280
     catattaatt cattaaaaaa atctatacta tattataata ggtctacaca aaggtgtggc      2340
     cactaa                                                                 2346
//

If you have problems or comments...

PBIL Back to PBIL home page