(data stored in ACNUC9543 zone)

EMBL: AL844507.PE195

AL844507.PE195       Location/Qualifiers
FT   CDS_pept        complement(join(899004..899078,899223..899312,
FT                   899443..899528,899633..899657))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819900"
FT                   /product="U6 snRNA-associated Sm-like protein LSm3,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0049:mRNA"
FT                   /db_xref="GOA:C0H4W2"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034105"
FT                   /db_xref="InterPro:IPR040002"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W2"
FT                   /protein_id="CAX64140.1"
FT                   /translation="MEKIALIQNPLDYIRLNMEEEIFLKCKGDRELIGKLDAYDNHLNM
FT                   ILSNVRETYKYSVKENDEETVKKMERNLDMVFVRGDSIILVSSAMK"
     atggaaaaaa tagcattaat acaaaatccc ttagattata ttcgtttaaa tatggaggaa        60
     gaaatatttt taaaatgtaa aggagataga gaactcattg gaaaattaga tgcttatgat       120
     aatcacttaa atatgatttt atccaatgta cgtgagactt ataaatatag cgttaaagaa       180
     aatgatgaag aaacagtcaa gaaaatggaa agaaatttag acatggtttt tgttagagga       240
     gattctatta tcctagtatc atctgctatg aaataa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page