(data stored in ACNUC9543 zone)

EMBL: AL844507.PE199

AL844507.PE199       Location/Qualifiers
FT   CDS_pept        919055..920896
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0047:mRNA"
FT                   /db_xref="GOA:Q8IB38"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB38"
FT                   /protein_id="CAD51171.1"
FT                   /translation="MEEKLIQTHITLLFYLILLFYLKNFTISFIDVPKKLFNYIKVYYS
FT                   FLILLTILGFFSKLLVLIRIFITHNINKIFRLLLRNNVNFECIKNHIRFNKSRKKVNYK
FT                   DEKKLITNVVYNKSINSDNKNNSYNNNNNNNIQTSNNTGRKRFYLFINKNADQQNNAIF
FT                   KKSNPDDLITTSIRERHQGDGSNNSTKQKRSKKRTKLLKKLKILKRDDNKQNEEHDEDK
FT                   DIKDDNQNNDYCSDDHEGNENDDDNNNNNNNNIYMEENKNVNKNNLKCKKHANSSHENY
FT                   TETLCEECDAMINLKNKIIKKNEINMNDQDSDETFEDNKDSLTELGFNKSINEKNFYLF
FT                   SLLSNILYNNTSNCSNVKKKKDGVLYNNKNNDNIMNNDNIMNNNNYIDDGYMNSDISSD
FT                   TFNDLESDNNSESITSDEHLAHAQNKFRNCKNNMLDNHNKSKSNNNYNSFSNYSSDSIY
FT                   SSDSIYSSDSNYNNENPSSVIKKMNPSNNVILNNESNKRIEIKSINLNTNQETKPLKSI
FT                   LKKCNNNTTSDKNKNNNRHIRFNNDVETYFFEKYLFEDDMYSIIDPRRTFYKILEAYNI
FT                   TNTEIFSYCNMRHNLNVVFNDIINSVFIYKDKIVKKF"
     atggaggaaa aacttataca gacacatata acgttgttat tttatttaat acttttattt        60
     tatttaaaga actttacaat aagttttatt gatgtaccta agaaattatt taattatatt       120
     aaagtgtatt attccttttt gattcttctt acaatacttg gattctttag taaattgctt       180
     gtactcatac gtatattcat aacacataat ataaacaaaa tatttagatt attattaagg       240
     aataatgtaa attttgagtg tattaaaaat catataagat ttaataagag taggaaaaaa       300
     gtaaattaca aagatgaaaa aaaattgata acaaatgttg tttataataa atctataaac       360
     agtgataata aaaataatag ttataataat aataataata ataatattca gacatctaat       420
     aatacaggaa ggaagagatt ttaccttttc attaataaaa atgcagatca gcaaaataat       480
     gctatattta aaaaaagtaa tcctgatgat ttaataacca cgtccataag ggaaaggcac       540
     caaggggatg gttcaaataa tagcacaaaa caaaaaagat cgaaaaaaag aactaaactt       600
     ttgaagaaat taaaaatatt aaaaagggat gataacaagc aaaatgaaga acatgatgaa       660
     gacaaggaca taaaggatga taatcagaat aatgattatt gtagtgatga tcatgaggga       720
     aatgaaaatg atgatgataa taataataat aataataata atatatatat ggaggaaaat       780
     aaaaatgtga ataaaaataa tttaaaatgt aaaaaacatg caaattcttc acatgagaat       840
     tatacagaaa cattatgtga agaatgtgat gctatgataa atttaaaaaa taaaataata       900
     aaaaaaaatg aaattaatat gaacgaccag gatagtgatg aaacgtttga agataataaa       960
     gatagtttaa cagaattggg ttttaataaa agtataaatg aaaagaattt ttatttattt      1020
     tcacttttat caaatatatt atataataat acatcgaatt gttcaaatgt aaagaaaaaa      1080
     aaagatggtg ttttatataa taataaaaat aatgataata ttatgaataa tgataatatt      1140
     atgaataata ataattatat tgatgatgga tatatgaata gcgatataag tagtgatacg      1200
     tttaatgatt tagaaagcga taacaacagc gaatcaataa ctagtgatga gcatttagct      1260
     catgctcaaa ataagtttag gaattgtaaa aataatatgt tggataatca caataaatca      1320
     aaaagtaata ataattataa tagttttagt aattatagta gtgatagtat ttatagtagt      1380
     gatagcattt atagtagtga tagtaattat aataatgaaa atcctagtag tgtgatcaaa      1440
     aaaatgaatc catccaataa tgttattctt aataatgaga gtaataaaag aatagaaatt      1500
     aaaagtatta atctaaatac aaatcaagaa acaaaaccat taaaatctat tttaaaaaaa      1560
     tgtaataata atacaacttc tgataaaaat aaaaataata atagacatat acgatttaat      1620
     aatgatgttg aaacttattt ttttgaaaaa tatttatttg aagatgatat gtatagtatt      1680
     atagatccaa gaagaacttt ttataaaatc cttgaagctt acaatataac caacacagaa      1740
     atttttagtt attgtaatat gcgtcataat ttaaatgtag tttttaatga cataattaat      1800
     tcagttttta tttataagga taaaatagtt aaaaagtttt aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page