(data stored in ACNUC9543 zone)

EMBL: AL844507.PE2

AL844507.PE2         Location/Qualifiers
FT   CDS_pept        complement(join(29700..30878,31636..39033))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800200"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0141:mRNA"
FT                   /db_xref="GOA:Q8IAK2"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK2"
FT                   /protein_id="CAD51362.1"
FT                   /translation="MGSQGSKPVDTSDVKNESHNSARNVFENIAEIIYNRVKEDAEKRG
FT                   KSLKGDYKRAKFHQPLLEAAKYVWYAPSNPCNFDFRFDTNAPDKGSYDRDPCHLRDTNR
FT                   FSDKGDAICTNNKINCNNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMA
FT                   KREGDSIVNSHGHTGKGIYKSGICTSLARSFADIGDIIRGKDLFLGHNHKKKPLLDNLE
FT                   KIFNRFQKIYEDINNLPIDDIREYWWALNRNDVWEALTCSAPYYADYFKKKSGNTYNFT
FT                   TEGYCGRNEGAPPTNLDYVPQFLRWFDEWAEEFCRIKNIKIGNIKKSCTGESNNKHCSR
FT                   EGYDCNKTNLRLNEIFMDLECPRCADDCKSYETWVENKKKEFNKQKEKYKEEINESKPG
FT                   VNSEHGKYNKAFYDKLRTIYRTNDKFFEILNKGQICENVDEKNKIDFNDLVKTFSRSEY
FT                   CKSCPMLGVTCKGEQCNSLDDITCTNDKGGPNKVTDKNNNTFVIDILLNDNKKKVLSND
FT                   LNDYKECDLFKRLRRQNWNCKYKCNLHVCELNNFNNEIDDERVISIKVFIKRWLESFLK
FT                   DYNKLKENLNPCINNENQLPCIKDCLENCDCVEKWIKKKGEEWKKIKERYLKDYKIEDN
FT                   NSSNSLNKFLQQNQFHSDVVKAIKPFENLRAFEDSSGCTGTVPSGIEECKSNDVIKILL
FT                   SKLKEKIELCKKNDVKKNKSNNCVTLLKPLNDEEDDEEQDDEPPAPKPLPTPNPCVNGG
FT                   DDTSGAQITSVTEIAEGMHMGAQKQMLERSGDKSGKGTENGESVLKGDIKKAKFKNGAS
FT                   PSSLEDVCGITDQHTKDSRRRRRLRRLRLLVLRFRRRLRRGHRDYKGPCTGKDGHKKMF
FT                   QVEKGWENGSKIGTENDVFLPPRREHFCTSNVEHLYRSASGLQGTTASHSLLGDVLLAA
FT                   NKEAGFIKERYKTQKTSEGFKDEATVCRAIKYSFADIADIIKGTDLWKANSGKKNTQDK
FT                   LVKIFQKIKDNLPVNIKGKYNEDEKHLELRKDWWFANRDKVWEAMKCEQNGITCSGPTP
FT                   LDDYIPQRLRWMTEWAEWYCKAQKEAYDKLKVCEKCMDNGKCTQGNGECAKCKTACENY
FT                   KKFINTWQPQWKQMEQKYESLYKEAQENGNSSHKSTTEQDKYMVEFLSQLQKANNGDKT
FT                   GDDKVYSTAAGYVHQEATMNCEKQTQFCKNKNGVKAANDAEDVNYTFKDTPNGYDVVCK
FT                   CKDRPEQQIKKKEVEDACKIAQDIFKGKDENTTVGLCKKKDFGRTPYPDWKCEKNSKLV
FT                   TGNGECMPPRRQKLCLYFLAHKIETPNLNTQEDLRKAFIKCAAAETFFSWYYFKKINDK
FT                   LNKLDEKLKEGEIPPQFLRSMFYTFGDYKDICLDTDISLKTENGDITKAKSNIDRIIPK
FT                   KSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNDKATVQKTLTTKTIYDYDTVTFD
FT                   GTTKLEDFSKRPQFLRWMTEWGEEFCKKRKEQLENLKDKCPDYTCSFDTKKQECENHCK
FT                   VYEEWLKGWKDQYKKQSEKFTTDKEKPEYKDDPDVASSENAHKYLSKKLKQIFHNGSTT
FT                   EKCDYTCMEYASRQPQTSACSQQQQQQNKSSTQNHFPEAFDYPPKEIGDRCTCPKLPEP
FT                   KYCVDKTAYDIRKESGKKSDNSLKGNGNTYNNNCNNSMREEYANQNGETCKFNETFWSK
FT                   KKPSIEECDINAKERFQIQKYWDCNGKTPDGKNTFCIPPRRKDMCLKQLEEINSADVNN
FT                   SKKLLQKIQDVAKKEGDDIIKKLLPKYPCNEDVICKAMKYSFADLADIVRGIDKYKGPN
FT                   GTNVLEKELKSVFETIYTKWKSENTNNKSKYTDVASFRSAWWDANRKDIWNAMTCNAPY
FT                   DAKIYITKEGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWSETYCLAQKDLLET
FT                   MKNCENCMKKNKNADCEQTQYGACRDCKRKCEEYKKFIEIWKKQFETQNKAYQEIYRNA
FT                   TTTNRDNNNIVDENTKNFVKKLQENCRTDRNESLDTADKYLENASVCRRFKFGNKDSRH
FT                   LNYAFHTDPPSYEEHCKCAKDFDPLDECPVDNNECKKYGIGSCPKKNFHKKLEEWTNYV
FT                   LNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEAKMLTEQYRE
FT                   NPAKALQAIKYSFADIGNIIKGDDIIGNVISVQLNKLINGNKKINTSTLWWEANKEKIW
FT                   NAMMCYYTGDEKTATSCPSHGNIDKEDQFLLWFQEWGENFCARQKELYEHVQAECSHVI
FT                   CVNGTGNIDSKCTEACKNYSNFISETKNVYQSLKKQYNDNHNSIKVGGKEVHHYMKEKC
FT                   KDKCECLSEKFNSDNNWEKPYDTFDDTVLKNKCQCKKPDSPILPVEPSVPAETEKEKKK
FT                   DSPLKPHTEPKPAPPKKPEVPPPPPVQPPPANQPFNRDILEKTIPFGIALALGSIAFLF
FT                   IKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYIYMEGDSDSGHYY
FT                   EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDTPSSDAPMNKFTDDEW
FT                   NQLKQDFISGILENEQKDLPKNNISGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSG
FT                   EEINYNINMSTNSMDDTSYVSNNVYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTN
FT                   YKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEKWKSKEDILHKLNEQWNKDND
FT                   GGNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDTILDDIEDDIYYDVNDDENPSVDNI
FT                   PMDHNKVDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI"
     atgggatctc aaggatctaa acctgtggat acaagcgatg ttaaaaatga aagtcacaac        60
     agtgccagaa atgtttttga aaatattgca gaaataatat acaaccgagt gaaagaagat       120
     gcagaaaaac gtggtaaatc tttgaaagga gattataaga gagcaaaatt tcatcagccc       180
     ttattagagg cagcgaaata tgtttggtac gctcctagta atccatgcaa ttttgatttt       240
     aggtttgata ctaatgctcc ggataaaggt tcatatgata gagatccttg tcatttgaga       300
     gatacaaatc gtttttcaga caaaggagat gcaatatgta ctaataataa aataaattgt       360
     aataatggtg gttgcggagc ctgtgctcca tatagaagaa tacagttatg cgattataat       420
     ttagaatata taaatgaata taatattaat agtacacatg atttattggg gaacctatta       480
     gttatggcaa aacgagaagg tgattctatt gtgaacagtc atggacatac aggtaaaggt       540
     atttataaat caggtatatg tacttctctt gctcgaagtt ttgcagatat aggtgatata       600
     atcagaggaa aagatctttt tctggggcat aatcataaaa aaaaaccatt actggataat       660
     ttagaaaaga tttttaatag atttcaaaaa atatatgaag acattaataa ccttccaatt       720
     gatgatatta gagaatattg gtgggcactt aatagaaatg atgtatggga agcattgaca       780
     tgctctgccc catattatgc tgattatttt aaaaaaaaat caggtaatac ttataacttt       840
     acaactgaag gatattgtgg ccgtaatgaa ggtgctcctc ctaccaattt agattacgta       900
     cctcaatttt taagatggtt tgatgaatgg gcagaagagt tttgtcgaat aaaaaatata       960
     aaaataggaa atattaagaa atcctgtact ggagaaagta ataataaaca ttgtagtcgt      1020
     gagggttacg attgtaataa aacaaatcta agacttaatg aaatttttat ggatctagaa      1080
     tgtccacgtt gtgcagatga ttgtaaatcg tatgaaacat gggtagaaaa taaaaaaaaa      1140
     gaatttaata aacaaaaaga aaaatacaaa gaggagatca atgagagcaa acctggtgtt      1200
     aattcagaac atggaaaata taataaagca ttttatgata aactaagaac gatatataga      1260
     acaaatgaca aattttttga aatattgaat aaaggacaaa tatgcgaaaa tgttgatgaa      1320
     aagaataaaa tagactttaa tgaccttgtg aaaacatttt cgcgttcaga atattgtaaa      1380
     tcatgtccta tgttaggtgt tacctgtaag ggtgaacaat gcaattcact tgatgacatc      1440
     acttgtacaa atgataaagg gggtcctaat aaagtaacgg acaaaaataa caatacattt      1500
     gttattgata tcctgttgaa tgataataaa aaaaaagtac tttctaatga tttaaatgat      1560
     tataaagaat gtgatctttt taaaagacta agaaggcaaa attggaattg taaatataaa      1620
     tgtaacttac atgtatgtga actgaataat ttcaataatg aaatagatga tgaaagagtt      1680
     atttcaatca aagtatttat taaacgttgg ttagagtctt ttttaaaaga ttataataaa      1740
     ttaaaagaaa atttaaatcc atgtataaat aatgaaaacc agttgccttg cataaaagat      1800
     tgtctggaaa attgtgattg cgtagaaaaa tggataaaaa aaaaagggga agaatggaaa      1860
     aaaataaaag aacgttacct aaaagattat aaaattgaag ataacaatag ttctaatagt      1920
     ttaaataaat ttttgcaaca aaatcaattt catagtgatg ttgtaaaagc tataaaacct      1980
     tttgaaaatt tacgcgcttt tgaggactca agtggatgta ctggaactgt accctcagga      2040
     atcgaagagt gtaaaagtaa tgatgtaatc aaaattctac tctctaaact taaagaaaaa      2100
     atagaattat gtaaaaagaa tgatgtcaaa aaaaataaaa gtaataattg cgttacgtta      2160
     cttaaacctc taaatgacga agaagacgat gaagaacaag acgacgaacc acctgcacca      2220
     aaacctcttc ccacccctaa tccgtgtgtc aatggtggag acgacacaag tggtgctcaa      2280
     atcacgagcg tgacagaaat tgcagaaggg atgcatatgg gggcgcaaaa acaaatgtta      2340
     gagcgtagtg gtgataaaag tggtaagggt actgaaaatg gtgagagtgt gttgaaaggt      2400
     gatataaaga aagcgaaatt taaaaatgga gctagtccga gttcattgga agacgtatgt      2460
     ggtataacgg accaacatac caaggatagt cgtcgtcgtc gtcgtcttcg tcgtcttcga      2520
     cttcttgttc ttcgttttcg tcgtcgtctt cgtcgtggtc atcgagatta taaaggacca      2580
     tgtacaggta aagatggaca caaaaagatg tttcaggtag aaaaaggatg ggaaaatggg      2640
     agcaaaatag gtacagaaaa tgacgttttc ttgccaccaa gacgtgaaca tttttgtact      2700
     tccaatgtgg aacatttgta cagaagtgcc agcggacttc aaggaactac tgccagccac      2760
     tctctattgg gggatgtgtt acttgctgcg aataaagaag caggattcat aaaagaaaga      2820
     tataagacgc aaaaaacttc agaaggtttt aaggacgagg caactgtgtg tagagcaata      2880
     aaatatagtt ttgctgatat tgcagatata attaaaggaa cagacttatg gaaagcaaat      2940
     tccggaaaaa aaaatacaca agataaattg gtaaaaatat ttcaaaagat taaagacaat      3000
     cttcctgtta acatcaaagg aaaatataac gaagatgaaa aacatttaga attacgtaag      3060
     gattggtggt ttgctaaccg tgacaaagtc tgggaagcaa tgaaatgcga acaaaacggt      3120
     atcacttgta gtggtcctac cccattggat gattacatcc ctcaaagatt acgttggatg      3180
     accgaatggg cagaatggta ttgtaaagca cagaaagagg cgtatgacaa gttgaaggtg      3240
     tgtgagaaat gtatggataa tggaaaatgt acgcaaggta atggcgagtg tgcaaagtgc      3300
     aagacagcat gtgaaaatta taaaaaattt attaatacat ggcaacctca atggaaacaa      3360
     atggaacaaa aatacgaaag tttatacaaa gaagcacaag aaaatggtaa tagtagtcat      3420
     aaaagtacta cagaacaaga caaatatatg gtagaattcc tgtcacaatt acaaaaagca      3480
     aataatggcg acaaaactgg tgacgataaa gtgtattcta ctgctgcagg atatgtacac      3540
     caagaagcta caatgaattg tgagaaacaa actcagtttt gtaaaaacaa aaatggtgtc      3600
     aaggcagcta atgatgcaga agacgtcaat tataccttta aggatacgcc taatgggtat      3660
     gatgtggtat gtaaatgtaa agataggccg gagcaacaga taaaaaaaaa ggaagtagaa      3720
     gatgcgtgca aaatagcgca ggacatattt aagggtaagg atgaaaacac tacagtaggg      3780
     ctatgcaaaa aaaaagattt tggaagaact ccttatcccg attggaaatg tgaaaaaaat      3840
     tcaaaattgg tgacaggaaa tggtgaatgt atgcctccaa gaagacaaaa gttatgttta      3900
     tactttttgg cacataaaat tgaaacacca aatttaaata cacaagaaga tttgagaaag      3960
     gcttttatta aatgcgctgc tgcagaaaca ttcttctcat ggtactactt taagaaaata      4020
     aatgataaat taaataaact cgatgaaaaa ttaaaagaag gagaaatccc tcctcaattt      4080
     ttaagatcca tgttctacac atttggagat tataaagata tatgtttgga tactgacata      4140
     tctttaaaaa ctgaaaatgg tgatataact aaggcaaaaa gcaatataga cagaattatc      4200
     ccaaaaaaaa gtgccaaaaa tcctgatgaa gaacgtaaaa tttggtggga tggaattaaa      4260
     gaagatgtat gggaagggat gttatgtgga ttatcacatg ctgtcagtaa taatgacaaa      4320
     gcgacagtac aaaaaacact tactaccaag accatctacg actatgacac tgtgacattt      4380
     gatggtacca ccaaattgga ggatttctcc aagcgacccc aatttttgag atggatgacg      4440
     gaatgggggg aagagttttg taaaaaacgg aaggaacaat tagaaaattt aaaagacaaa      4500
     tgtccagatt atacgtgtag cttcgatact aaaaaacaag aatgtgaaaa tcactgtaaa      4560
     gtatatgaag aatggctaaa aggttggaaa gaccaatata aaaaacaaag cgaaaaattt      4620
     acaacagata aagaaaaacc tgaatataaa gatgatcccg acgttgccag ctccgaaaat      4680
     gctcacaaat atttgagcaa aaaattaaaa caaatttttc acaatggaag tactactgag      4740
     aaatgtgatt atacgtgtat ggaatatgcg tcaagacaac cacaaacatc tgcttgcagt      4800
     caacaacaac aacaacaaaa caaatcatct acacaaaacc atttccctga agcgttcgat      4860
     tatcctccta aagaaattgg tgataggtgc acttgtccta aacttccgga acctaaatat      4920
     tgtgtagaca aaaccgcata tgatataaga aaagagagtg ggaaaaagtc ggataatagt      4980
     ttgaaaggaa atggtaatac atacaataat aattgtaata attccatgag ggaagagtat      5040
     gccaatcaaa atggagaaac atgtaaattt aacgaaacat tttggtccaa aaaaaaacct      5100
     tctattgaag aatgtgatat caatgcaaaa gagcgttttc aaatacagaa atattgggat      5160
     tgtaatggga aaacacctga tggaaaaaac acattttgta tccctccaag aagaaaagat      5220
     atgtgcttga aacaattgga agaaataaat tctgcagatg ttaataatag caaaaaatta      5280
     cttcaaaaaa tccaagatgt agcaaaaaag gaaggagatg atataataaa gaaactatta      5340
     ccaaaatatc cttgtaatga agatgtaatt tgtaaagcta tgaagtatag ttttgccgat      5400
     ttagcagata ttgttagagg tatagataaa tataaaggtc caaatggtac caatgtactt      5460
     gaaaaagaat taaaaagtgt ttttgagaca atatatacaa aatggaaatc cgaaaacaca      5520
     aataataaaa gtaaatacac cgatgtagcc tcttttcgtt ccgcctggtg ggatgctaat      5580
     agaaaagata tttggaatgc tatgacgtgt aatgctcctt atgatgcaaa aatttatatt      5640
     accaaagaag gaggatatat atctccttta acgttcacaa aaaacaaatg tgggcataat      5700
     gatgatccac ctgattatga ttatatccct caaccttttc gatggctaag tgagtggagc      5760
     gaaacctact gtcttgctca aaaagattta ttggaaacga tgaaaaattg tgagaattgc      5820
     atgaaaaaaa acaaaaatgc agattgtgaa cagacacaat atggagcttg tagggactgt      5880
     aaaagaaaat gtgaagaata caagaaattt atagaaattt ggaaaaaaca gtttgaaaca      5940
     caaaacaaag catatcaaga aatatataga aatgctacaa caactaacag agataataat      6000
     aatattgttg atgaaaatac aaaaaatttt gtaaaaaaac tacaggaaaa ttgcagaacc      6060
     gaccgaaacg aatctcttga tactgccgat aaatatcttg aaaatgcaag tgtttgtcga      6120
     agatttaaat ttgggaataa ggactcacgt catctaaatt atgctttcca tacagatcca      6180
     cctagttatg aagagcattg caaatgtgcg aaagattttg atccattgga tgaatgtcct      6240
     gttgataata acgaatgtaa gaagtatggt ataggtagtt gtccaaaaaa aaatttccat      6300
     aaaaaattgg aagaatggac aaattacgtt ttaaacaaca aatcaaataa aaataaatcc      6360
     gcaatagtac ctcccagaag gagacaatta tgtctacaaa atcttacgag aaatttgagt      6420
     cgtctaaata aagaaaaatc atttaaagaa ggaattctta tttcagctgc ttcggaagct      6480
     aaaatgttaa ctgaacaata tcgtgagaat cctgcaaagg cacttcaagc aataaaatac      6540
     agttttgctg atattggaaa tattataaag ggagatgata ttatagggaa tgttatatct      6600
     gtccaactaa ataagttaat taacggaaat aaaaaaataa atacatctac cttatggtgg      6660
     gaagcaaata aagaaaaaat ttggaatgcc atgatgtgtt attacactgg agacgaaaaa      6720
     acagctacta gttgtccatc acatggaaat attgataaag aagatcaatt tttactatgg      6780
     tttcaggaat ggggagaaaa tttctgtgct agacaaaaag aattatatga acacgtacaa      6840
     gcggaatgta gtcatgttat atgtgtcaat ggtactggaa atattgacag taaatgcact      6900
     gaagcatgta aaaattatag taattttatt tcagaaacaa aaaacgtata tcagtcatta      6960
     aagaagcaat ataatgataa tcataactct atcaaagtag gtggtaaaga agttcatcat      7020
     tatatgaaag aaaaatgtaa agataaatgt gaatgtttgt ctgaaaaatt taacagtgac      7080
     aacaattggg aaaaaccgta tgacacattt gacgataccg tactcaaaaa caaatgtcag      7140
     tgtaaaaaac ctgattcccc aattcttcca gtagaacctt cagtgccagc tgaaacggaa      7200
     aaagaaaaaa aaaaagattc acctcttaaa ccccatactg aaccaaaacc tgcacccccc      7260
     aaaaaacctg aggtaccccc gcctccaccc gtacaacccc cccctgcgaa ccaacccttc      7320
     aatcgtgaca ttctggaaaa gaccattcct tttggtattg cgttggcgtt aggttcgata      7380
     gcgttccttt tcataaagaa aaaaccgaaa tcacctgttg acctcatacg tgtacttgac      7440
     atccacaaag gagattatgg aatgcctaca ctgaaatcaa aaaatcgata tataccctat      7500
     gctagtgata catataaagg caaaacatac atttatatgg aaggagatag tgatagtgga      7560
     cactactacg aagatacaac tgatattact tcatccgaaa gtgaatatga agaaatggat      7620
     attaatgata tatatgtacc tgatagtcct aaatataaaa cattgatcga agtagtattg      7680
     gaaccatcaa aaagagatac acctagtagt gatgcaccta tgaataaatt tactgatgac      7740
     gaatggaatc aactgaaaca ggattttatt tccggaattt tagaaaatga acaaaaggat      7800
     ttacctaaaa ataatataag tgggaatact ccaatgaata cacaacccaa tactttatat      7860
     tttaataaac ctgaagaaaa accttttatt acttctattc atgataggga tttatatagt      7920
     ggagaagaaa ttaattataa tataaatatg agtactaata gtatggatga tacatcatat      7980
     gtatcaaata atgtatattc tggtatcgat ttaattaatg acacattaag tggtaaccaa      8040
     catattgata tatatgatga agtgctaaaa agaaaagaaa atgaattatt tggaacaaat      8100
     tataagaaaa atacatcaaa caataatgta gctaaattaa caaatagtga tccaattatg      8160
     aaccaattag atttgttaca taaatggtta gatagacata gagatatgtg tgaaaaatgg      8220
     aaaagcaagg aggatatatt acataaatta aatgaacaat ggaataaaga taatgatgga      8280
     ggtaatgtac caatagataa cagatcgttg aatacggatg tttggattga aatagatatg      8340
     gatgatccta aaggaaagaa agaatttagt aatatggata ctatcttgga tgatatagaa      8400
     gatgatatat attatgatgt aaatgatgat gaaaacccat ctgtggataa tatacctatg      8460
     gatcataata aagtagatgt acctaagaaa gtacatgttg aaatgaaaat ccttaataat      8520
     acatccaatg gatccttgga accagaattt cctatatcgg atgtatggaa tatataa         8577
//

If you have problems or comments...

PBIL Back to PBIL home page