(data stored in ACNUC9543 zone)

EMBL: AL844507.PE201

AL844507.PE201       Location/Qualifiers
FT   CDS_pept        925113..927671
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820500"
FT                   /product="protein transport protein YIF1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.57:mRNA"
FT                   /db_xref="GOA:Q8IB40"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB40"
FT                   /protein_id="CAD51169.1"
FT                   /translation="MSYNNNYVDFNIHDRRKTNNANFKEEENSWSNMSFSKGNNLNNNV
FT                   MKRGGHMDITNNKNFMDININDMNRMNNMNNFYSGHVTDVNNTENDESAHLLNKNVQVD
FT                   NTYVNNLINPNDNVTHPFAKNINNNTSSSNYVSAHPIIGRNKTKDISNSSYNNRSNTST
FT                   INNHNNNNINNNNNNINNNNNINNNSNIFNNNDNKKYSYIHNSNTTMMKPSNIILNHHH
FT                   NNNNNNNVTNNLGSTNFNVNNKVSSHSNLLYNNKNFSNNNNNNFFQNNNNNNNSSSSNN
FT                   RISNSNLAIEQNYCNQFLKSNDSKEGRNVVLSDNLPFVNNVKVDNDLNNKNIFNNYKTN
FT                   YNDKNFEQNNMNISGNSMNQFNNNMNSSGDNSFVGSVVSSVIGSTASNFFQNKFLNNKE
FT                   SNVESNKGIVHNIFERLTNDKESKNEINNLVQQKVANMVINEIEKKIEINQTSFICNKL
FT                   SVLREYFDVTHAYVIQKILFILIPYIYIRKALCESRTYYVYTHFKRKMESSEKNKTFNS
FT                   AFILNNDNSNFTRPNSSINNEYAQQQGGSFFYNDKSKGYMSNTHNNMNNNVNNNMNNNM
FT                   NNNMNNNMNNNMNNNMNNNMNNNMNNNMNNSMARHNSNDINYVDYSNVGIFKADLYIPL
FT                   MSSITYILLYTLTITAQKQNATFNPDNLFNISSYVFILLFLETAIIKFLFLLTCRDINL
FT                   SFLHILSFISYKFVIMCALIITKIFFYFLYFMYASVFGGGGTFPDISMKNNLHVNKKML
FT                   SNNSHNTFKNMNYQNISKFSPFNIVLFLNSTTTYRLTQLYFYITVTIQMIQIFKSIHLY
FT                   IHDNNSNLSHKVNIKRINVLILIFSLSQIFLCWILTPSFT"
     atgagttata ataacaatta tgtagatttc aatattcatg atcgtagaaa aacaaacaat        60
     gcgaatttta aggaggaaga gaattcttgg agtaatatga gtttcagcaa aggtaataat       120
     ttgaataata atgtaatgaa aagaggagga catatggata taacaaataa taaaaatttt       180
     atggatataa atattaacga tatgaataga atgaataata tgaataattt ttatagtggg       240
     cacgttacag atgttaataa tacggaaaat gacgaatcag cacatttatt aaataaaaat       300
     gtacaggtgg ataatacgta tgtaaataat ttgattaatc caaatgataa cgtgactcac       360
     ccttttgcaa aaaatataaa caataatacg tcctcatcaa attatgtgtc agctcatcct       420
     attataggaa gaaacaaaac gaaggacata tcaaatagta gttataataa taggagtaat       480
     accagtacaa taaataatca taataataat aatattaata ataataataa taatattaat       540
     aataataata atattaataa taatagtaat atttttaata ataatgataa taaaaaatat       600
     tcttatatcc ataattcaaa cacaaccatg atgaaaccat ctaatataat attaaatcat       660
     catcacaata ataataataa taataatgtt acaaataatt taggtagtac caattttaat       720
     gtaaataata aagtttctag ccatagcaat ttattatata ataataaaaa tttctcaaac       780
     aataataaca ataatttttt tcaaaataat aataataata ataatagtag tagtagtaat       840
     aatcgaatta gtaactctaa cctagcgata gaacaaaatt attgtaacca atttttaaaa       900
     agtaacgatt caaaggaagg aagaaatgta gttttatcag ataatcttcc ttttgtaaat       960
     aatgttaaag ttgataatga tttaaataat aagaatattt ttaataatta taaaacaaat      1020
     tataatgata aaaatttcga acaaaataat atgaacatat caggtaatag tatgaaccaa      1080
     tttaataata atatgaacag ttcaggtgat aatagttttg ttggaagtgt agttagtagt      1140
     gttataggat cgactgcatc gaattttttt cagaataaat ttttaaataa taaagagagc      1200
     aacgttgaaa gcaataaagg aattgtacat aatatatttg aaagattaac aaatgataaa      1260
     gaatcaaaaa atgagataaa taatttggta caacaaaagg ttgcgaatat ggtgatcaat      1320
     gaaatagaga aaaaaattga aataaatcaa actagtttta tatgtaacaa attatctgtt      1380
     ttgagagaat attttgatgt aactcatgca tatgttatac agaaaatatt atttatattg      1440
     attccttata tatatattcg aaaggcttta tgtgaatcaa gaacatatta tgtatataca      1500
     cacttcaaaa gaaaaatgga atcgtctgaa aaaaataaaa catttaattc tgcatttatt      1560
     ttaaataatg ataatagtaa ttttactagg ccgaattcga gtataaataa tgaatatgcg      1620
     caacaacaag ggggaagctt tttttataat gataagagta aaggatatat gagtaacaca      1680
     cataataata tgaacaataa tgtgaataat aatatgaaca ataatatgaa caataacatg      1740
     aacaataaca tgaacaataa catgaacaat aacatgaaca ataacatgaa caataacatg      1800
     aacaataaca tgaacaatag tatggcacga cataattcaa acgatattaa ttatgttgat      1860
     tatagtaatg tgggtatttt taaagcagat ttatatatcc ccttaatgtc aagtattaca      1920
     tatatattat tatacacatt aacaataacc gcacaaaaac aaaatgcaac ttttaatccc      1980
     gataacttgt ttaatatatc atcatatgta tttatcttac tatttttaga aacagctatt      2040
     ataaaatttt tatttttatt aacatgcaga gatattaatt tatccttttt acatattctt      2100
     tcttttatat catataaatt tgttattatg tgtgctttaa ttataacgaa aatatttttt      2160
     tatttccttt attttatgta tgcgtctgtc tttgggggtg gagggacatt tcctgatatc      2220
     agcatgaaaa ataatcttca tgtgaataaa aaaatgttat caaataattc acacaataca      2280
     ttcaaaaata tgaattatca aaatattagt aaattcagtc cattcaatat tgtgttattt      2340
     ttaaatagta cgactacata tagattaaca caattatatt tttatataac tgtgactata      2400
     cagatgatac aaatttttaa gtcaatacat ttatatatac atgataataa ttctaatttg      2460
     tcacataagg ttaatatcaa aaggattaat gtgcttatac ttattttttc tttatcacaa      2520
     atatttttat gctggatact tacaccatct tttacataa                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page