(data stored in ACNUC9543 zone)

EMBL: AL844507.PE202

AL844507.PE202       Location/Qualifiers
FT   CDS_pept        join(929145..929616,929798..930212,930381..930861)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.56:mRNA"
FT                   /db_xref="GOA:Q8IB41"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB41"
FT                   /protein_id="CAD51168.1"
FT                   /translation="MNLFSFLIFLLLLFFINLFFVKSNFKNDESYNIPLNVLFNKGKNI
FT                   RKRVCNECFYKNEVSLIFNSCKVLENVKNNNLNKAKIMSFIRQSPKMIKSYVTLKYKSR
FT                   FSEILSAKYIKKFLSSKKMLIFDVLFLLGKTYFKYNIMLSILALFKTIFIRFLAVYITQ
FT                   LLSSFLLFHYVNMFSQRTQAYILFISGSNYSSRIIGFFQLNIINYYINIFSEAVQIGLI
FT                   RILFNQYEVEKIKSILYNSSDYYINTTLTNKYSIMYQCTKRFVISRFNKLSIFTFNYLR
FT                   YFVLTNLFFKLFEGTYNKYSPSDVKMPGVYSDKKKSLNKDMKYATKREINILKNFCKDT
FT                   GCHTCGMTCHEKFIGDHQPPVQIIKDMVNYYKKRKFILYFLKLFKLYDTKQRLYPQCIR
FT                   CSQLQSASVRCKKLRLIPHYKTIRMFHYSSIFHLFLKMLLLTNWKQIIFWDKNSIN"
     atgaatctct ttagctttct gatatttttg ttacttttat tttttataaa tttatttttt        60
     gtaaaatcta atttcaagaa tgatgaaagc tacaatatac cattgaatgt attatttaat       120
     aagggcaaga atataaggaa aagagtatgt aatgagtgtt tttataaaaa tgaagttagt       180
     ttaatattta atagttgtaa ggtattggaa aatgtaaaaa ataataatct aaataaagct       240
     aaaataatgt cttttattag acagtctcct aagatgataa aaagttatgt taccttgaaa       300
     tataaatcca gattctctga aatcctttct gctaagtata ttaaaaaatt tttatcatca       360
     aaaaaaatgt tgatatttga tgtattgttt ttattaggga agacatattt taagtataat       420
     ataatgctta gtatcttggc tttatttaag accatcttta taagatttct tgctgtttat       480
     attacccaac ttttgtcttc cttcttacta tttcattatg taaacatgtt ttcacaaagg       540
     acacaagcat acatactttt tataagtgga tcaaactata gctctagaat tataggattt       600
     tttcaattaa atataattaa ttattatatt aatattttta gtgaggctgt acaaattggt       660
     cttattcgta ttttatttaa tcagtatgaa gtagaaaaga taaaatccat tttatataat       720
     agttctgatt attatataaa cacaacgtta acaaataaat attctattat gtatcagtgt       780
     acaaagagat ttgttatttc aaggtttaat aagttgagca tatttacatt taattattta       840
     agatattttg tattaactaa tttgtttttt aagcttttcg aaggaacgta taataaatac       900
     tctcccagtg atgtgaaaat gccaggggtt tattcagaca aaaaaaagag cctgaataaa       960
     gatatgaaat atgcaactaa aagagaaata aatattttaa aaaatttttg taaagatact      1020
     ggatgtcata catgtggtat gacatgtcat gaaaagttta taggtgatca tcaaccacca      1080
     gttcaaataa taaaagatat ggttaattat tataaaaaaa gaaaattcat tttatatttt      1140
     ctcaaattat ttaaattata tgacaccaag caaagattat atcctcaatg tatcagatgt      1200
     tctcaactac aatctgcttc tgtacgatgt aaaaaattaa gacttatacc acattataaa      1260
     acaataagaa tgtttcatta ttcatccata tttcatttat ttcttaaaat gttattatta      1320
     accaattgga agcaaatcat tttctgggat aaaaatagta taaattga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page