(data stored in ACNUC9543 zone)

EMBL: AL844507.PE205

AL844507.PE205       Location/Qualifiers
FT   CDS_pept        complement(join(939583..940898,941076..943742,
FT                   943898..944645))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.54:mRNA"
FT                   /db_xref="GOA:Q8IB43"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB43"
FT                   /protein_id="CAD51165.1"
FT                   /translation="MKDNKMSKNNIFIYNEKVKELLYELILLTNKLSIYRKKYIKYIRR
FT                   KIDYDKYKYKSKFNNNDDNYAFLLFKNFNYHNEFLIHKYVKFKEGKRRYISNGKYKKEF
FT                   NSSYDILEYYDKFINNLLYLCNNHTDIYIEFLYVLLINSQLFNRFLFLSTYISGDKKDQ
FT                   FLYLIYNHFLILVEYYHYYKNSSYYDDLYNNLKNTYDKIQTKHNDKEHYIEIKNKNQNH
FT                   KRGNHNNLSCNTGLETNSVSPIQNFKKDPNTHTYKNFYKKERVKFLYNYSNKRNENFFT
FT                   INNCNSSSNECNQSFSEYEPLNKEAHEKSIFFNKEENVYYVDDDKNDNNLFNENVHKKK
FT                   KGKETKNIFNKFFFNLSESQNSLTNLYQNFYSKNKNRSYDSQFIDTKKRNSLQNKCFIF
FT                   TNVNNFNIKEYYKLKHIFSIFQKLKIEHLYILLYFSLSILSTLFHIYLTRIMLNRKNPF
FT                   FISTYLFYLSKKVKNKIFNNLYKYIQPNKDYMNRYMFKSDDMQEQKKKIINNDILINEY
FT                   VSNQIGNSVNEGKLYINVTKNNNNNNNNNKDKDNYDDDNNNCHVQEKDITYQDLSIHYL
FT                   INKYKHNIDNQFVNLYYKNKHNTSNDSITLFNHLTCENSLQNLNKIYVNHIINKFSKEK
FT                   ENDIDNMDSFNYDIKMLHTFQLQDNLKKLNFQILNTKHENYILEECNGVLENIINKEEY
FT                   NIISEEDEKIKDKANKNEKRQSSNQYNHNDDTIPYIHITEHKNDIIKENSKSNDEPIEG
FT                   CKKYEKSKKSINIPEQYINNDKFYKFIEHHLEMKYIYLYYKNIEKDKLLNYVGFENLIK
FT                   SLSIMCNEHFFSFYMNKINVKNMYEDNDNILNEAHNVNKHTIKTKIEKNKKHEEKNNKH
FT                   EEKNKKHEEKNKKHEEKNKKHEEKNKKHEEKNKKHEEKNPHESDDEEEEEEDNIDTLHL
FT                   NSIYKEPTLINNEYIKKKIKRNKLYTYKLFNNQIETLLNSKELMEYIKKQKEIKKKKNK
FT                   SELQNDDFLYIQSQNGNNVINNKDQHIYNDIFKFIQNKNYHNKNDDIIHTNCSSYENSD
FT                   SSDNLTLYNYSKNYYHQNNIILDSFLFFIIHIFYTFLHFHNVYFSSPYLNLFLSFSIKL
FT                   IYKYKNVVQCQSNDYNIDMSLDPSVLSYEKRENGPTINYDLPEQNIHSSNKPCNQINLL
FT                   RRKKNIQKTCTLYNNSKNHIYNACSSEDITSINEEVFNAPNIIELIIKKQKFINKKQKK
FT                   NYSFIGNDIFLFGKDKTKEFLPNTFDIIINSFFDLCISICSMNFKYISQKKQKLNMSYF
FT                   CNNIIFYHHIINKSYNDKALDLFNRNNYNHSLECYSYYFDELKNDQSFINHFGKYKNTD
FT                   TIFRHNIASQKKKKIINNKNKIISNIHKNNNHINDMIGMYKTKELSSNSSNILNENNLI
FT                   KRKSKEKKKESNHKNENSNNSFDGTSNYYNDDNNYNTYLSFSSDESLNFLKYIKKRTTN
FT                   RIYIDENNIINMLINIGCIFMNNIKYNAAITLNHIYKINQYDLLSDRQKFYHYIQKSFY
FT                   NNKHMTFPYIYNQYFISFFFFFKIHYLFFLIKFKCENEIFLKAYWFLHAVYNITQN"
     atgaaagata ataaaatgag taaaaataat atatttatat ataatgaaaa agttaaagaa        60
     ttattgtatg aacttatttt gttaactaat aagctgtcga tatatagaaa gaaatatatt       120
     aaatatataa gaagaaagat tgattatgat aaatataaat ataaatctaa atttaataat       180
     aatgatgata attatgcatt tttattattt aagaatttta attatcataa cgaattttta       240
     atacataaat atgtaaaatt taaagaaggg aaaaggaggt atatttcaaa tgggaagtat       300
     aaaaaagaat tcaattcttc ttatgatatc cttgaatatt atgataagtt tataaataac       360
     ttattatatt tatgtaataa tcatacagat atatatatcg aatttttata tgttttatta       420
     ataaacagtc aattatttaa tcgttttctt tttttaagta catacatatc cggggataaa       480
     aaagaccaat tcctttattt aatatataat cattttttaa tattggtaga atattatcat       540
     tattataaaa actcttctta ttacgatgat ctatataaca acttgaaaaa tacttatgac       600
     aagatacaaa ccaagcataa cgataaggaa cattacattg aaataaaaaa taaaaatcag       660
     aatcataaaa gagggaacca caataattta agttgtaaca cgggtttaga aacaaattca       720
     gtatcaccta tacaaaattt taaaaaagat ccaaatacac atacatataa aaatttttac       780
     aaaaaagaaa gagtaaaatt tctttataat tactcaaaca aaagaaatga aaattttttt       840
     acgattaata attgtaactc ttctagtaac gagtgtaatc aatccttctc agaatatgaa       900
     ccattaaaca aggaagcaca tgaaaaatct atatttttta ataaggaaga aaatgtttat       960
     tatgtagatg atgataaaaa tgataataac ttgttcaatg aaaatgtcca taaaaaaaaa      1020
     aaaggaaaag agacaaaaaa tatttttaat aaattttttt ttaatttatc agaaagtcaa      1080
     aatagtctta caaatttata tcaaaatttt tattcaaaaa ataaaaatag gtcatacgat      1140
     tcgcaattca tagatactaa aaaaagaaat tcattacaaa ataaatgttt catatttaca      1200
     aatgtaaata attttaatat taaagaatat tataaactga aacatatatt ttccatattt      1260
     caaaaattaa aaattgaaca tttatatatt ttattatatt tctctttgtc tatattatca      1320
     acattatttc acatttattt gacaagaatt atgcttaatc gaaaaaaccc tttttttata      1380
     agtacttatt tgttttattt atctaaaaag gttaagaata aaatttttaa taatttatat      1440
     aaatatatac aacctaataa agattatatg aataggtata tgtttaaaag tgacgatatg      1500
     caagaacaaa aaaaaaaaat aataaataat gatatattga taaatgagta tgtatcaaat      1560
     caaattggaa attcagtgaa tgagggaaaa ttatatatta atgttacaaa aaataataat      1620
     aataataata ataataataa ggataaggat aattatgatg atgataataa taattgtcat      1680
     gtacaagaaa aagatataac ttatcaagat ttatctatac attatttaat taacaaatac      1740
     aaacacaata tagataacca atttgttaat ttatattata aaaataaaca taacacatct      1800
     aatgattcta ttacattgtt caatcattta acatgtgaga attcactaca aaatttaaat      1860
     aaaatatatg tgaatcatat tattaacaaa ttttcaaaag aaaaagaaaa cgatatagac      1920
     aatatggatt catttaatta tgatataaaa atgttacata catttcaact tcaagataat      1980
     ttaaaaaaat tgaactttca aattcttaat acaaaacatg aaaactatat attagaagaa      2040
     tgtaacggtg tactagaaaa tataataaat aaagaagaat ataatatcat atctgaagag      2100
     gatgaaaaaa taaaagataa agcaaataaa aatgaaaaaa gacaatcatc caatcaatat      2160
     aatcataatg atgatactat tccttacata catataacag aacataaaaa cgatataata      2220
     aaagaaaata gtaaaagtaa tgatgaacct attgaaggat gtaaaaaata tgagaagtca      2280
     aagaaatcta ttaatattcc tgagcaatat attaataatg ataaatttta taaattcatt      2340
     gaacatcatt tagaaatgaa atatatttat ttgtattata aaaatatcga aaaagacaaa      2400
     ttattaaatt atgtaggttt tgaaaatcta ataaaaagct tgagtatcat gtgcaatgaa      2460
     catttctttt ctttttatat gaataaaata aatgtgaaaa atatgtatga agataatgat      2520
     aatatattaa atgaagctca taatgtgaat aaacatacta taaaaacaaa aatagaaaaa      2580
     aataaaaaac atgaagaaaa aaataataaa catgaagaaa aaaataaaaa acatgaagaa      2640
     aaaaataaaa aacatgaaga aaaaaataaa aaacatgaag aaaaaaataa aaaacatgaa      2700
     gaaaaaaata aaaaacatga agaaaaaaat ccccatgagt cggatgatga agaagaagaa      2760
     gaagaagata atattgacac attacattta aatagtatat ataaagaacc tacattaatc      2820
     aataatgaat atattaaaaa aaaaattaaa agaaataaat tatatacata caaattattc      2880
     aataatcaaa tagaaacttt attaaactca aaagaattaa tggagtatat aaaaaaacaa      2940
     aaagagatca aaaaaaaaaa aaataaaagt gaattacaaa atgatgattt tctttatata      3000
     caatcacaaa atggtaataa tgttataaat aataaagatc aacatatata taatgatata      3060
     ttcaaattta tacaaaataa aaattatcat aataaaaatg atgatatcat acatacaaat      3120
     tgtagttcat atgaaaatag tgattctagt gataatttaa cattatataa ttattctaaa      3180
     aattattatc atcaaaataa tataattcta gattcttttc ttttttttat aattcatata      3240
     ttttatacct tcttacattt tcataatgta tatttttcat caccctattt gaatctattc      3300
     ttatcctttt ctattaagct aatttataaa tataaaaatg tagtgcaatg tcaatcaaat      3360
     gattataata ttgacatgtc cctagatcca tccgttttat catatgaaaa aagagaaaat      3420
     ggacctacca taaattatga cttacccgaa caaaacatcc attcgtcaaa taaaccatgt      3480
     aaccaaatta accttttgag aaggaaaaaa aatattcaaa aaacatgcac actttataac      3540
     aatagtaaga atcatatata taatgcttgc tcttctgaag atataacaag tattaatgaa      3600
     gaggtattta acgcaccaaa tataatagaa cttattataa aaaaacaaaa attcataaac      3660
     aaaaaacaaa agaagaatta ttcgtttata ggaaatgata tatttttatt tggaaaagat      3720
     aaaacaaaag aatttttacc taacacattt gacataatta tcaactcttt tttcgattta      3780
     tgtatatcta tatgtagtat gaattttaaa tatatatctc aaaaaaaaca aaaattaaat      3840
     atgtcctatt tttgtaataa tataattttt tatcatcata ttataaataa atcgtataat      3900
     gacaaagctt tagatctatt caatagaaat aattataatc attcacttga atgctattct      3960
     tattattttg atgaattaaa aaatgatcaa agttttatta atcattttgg aaaatataaa      4020
     aacacggata ctatttttcg acacaacata gctagccaaa aaaaaaaaaa aataatcaat      4080
     aataaaaata aaatcatatc caatattcat aagaacaata accatataaa tgacatgata      4140
     ggaatgtata aaacaaaaga attatcaagt aatagttcga atatattaaa tgaaaataat      4200
     ttaataaaaa ggaaatcaaa agaaaaaaaa aaagaaagta accacaaaaa tgaaaatagt      4260
     aataattcat ttgatggtac atcaaattat tataatgatg ataataatta taacacttat      4320
     ctttccttta gtagtgatga aagcttaaac ttcttaaaat atattaaaaa gagaacaaca      4380
     aatcgaatat atatagatga aaataatata ataaatatgc ttattaatat tggatgtatt      4440
     tttatgaata atataaaata taatgcggct attacattaa atcatattta caaaattaat      4500
     caatatgatc ttttaagcga tagacaaaaa ttctaccatt atatacagaa atcattttat      4560
     aataataaac atatgacatt tccatatata tataatcaat attttatatc tttcttcttt      4620
     ttttttaaaa ttcattatct tttcttttta ataaagttca aatgtgaaaa tgaaattttt      4680
     cttaaggctt attggtttct ccatgccgta tataatataa ctcaaaattg a               4731
//

If you have problems or comments...

PBIL Back to PBIL home page