(data stored in ACNUC9543 zone)

EMBL: AL844507.PE206

AL844507.PE206       Location/Qualifiers
FT   CDS_pept        join(948745..949909,950078..950180,950274..950344,
FT                   950485..950609,950819..950899)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.53:mRNA"
FT                   /db_xref="GOA:Q8IB44"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB44"
FT                   /protein_id="CAD51164.1"
FT                   /translation="MESMPSETTINSEQYKSKESNNICRNEKSTAYSENSDISNNKEDY
FT                   NSDRKENFDKKLCDNMNDKINIYDNIISEIKELYNGNIVMNNKGLDKLNIRNVAKGLFL
FT                   NINKTISKKVRVLVIGNSSSGKSTFINWFLQENIQKTGYEYETNNFTLITSGNYFSEFN
FT                   GDITVRTFDFLKQISNRNRNFKNNLCTKMYVSKNMETKNIDFIDTPGLKDIMNKLDFDI
FT                   NSIIYDLSDYVDIILVFFDSSGKSLSNRLLLIIKEIYEKHMEKIIFIFSKIDEIKHEED
FT                   RIKLLCQTTQCLTTKINIRHNIDLLPIYIHGAKTGRYLFESNKNSDELCIVNRINDIIY
FT                   EIKKLFFKKLERDLYCLINDCDSIINKILDILKTDGERRMHKYSLKRERVKHTVIQVFL
FT                   FLVFMLLLFMQLPEQNYYKGLLLSHFNFGNNSVYIKYIKNTGVMLNNWENSYIMINVIL
FT                   VFFFLLSGIMKKKFSKNIKTLHVSSKEILREQLTFAKFAKDRGKYLAKTFYELKQT"
     atggagagca tgccgagcga gacaacaata aattctgaac aatacaaaag taaagaaagt        60
     aataatattt gcaggaatga gaaatctact gcgtattcag aaaattcgga tatatctaat       120
     aataaagagg attataatag tgatagaaaa gaaaattttg ataagaaatt atgtgataat       180
     atgaatgata aaataaatat atatgataat ataataagtg aaataaaaga attatataat       240
     gggaatatag ttatgaataa taaagggtta gataaattaa atattcgaaa tgttgctaaa       300
     ggattatttt taaatataaa taagactata tcaaaaaagg ttagagtatt agttatagga       360
     aattcttcgt caggaaaaag tacatttatt aattggtttt tacaagaaaa tatacaaaaa       420
     actggttatg aatatgaaac gaataatttt actcttataa ctagtggtaa ttatttttca       480
     gaattcaatg gtgatataac ggtaagaaca tttgattttt taaaacaaat atctaataga       540
     aatagaaatt ttaaaaataa tttatgtacc aaaatgtatg ttagtaaaaa tatggaaaca       600
     aaaaatatag atttcataga tacaccagga ctaaaagata ttatgaataa attagatttt       660
     gatattaata gtattatata tgatttatca gactatgttg atatcatatt agttttcttt       720
     gattcatctg gaaaatcatt aagtaatcgt ttattattaa ttattaaaga aatatatgaa       780
     aaacatatgg aaaaaattat ttttattttt tcaaaaattg atgaaatcaa acatgaagaa       840
     gatcgaatta aactcttgtg ccaaactact caatgtctaa caaccaaaat taatattaga       900
     cataatattg atttattacc tatatatata catggtgcaa aaacaggaag atatctattt       960
     gaaagtaaca aaaattctga tgaactatgt attgtaaatc gaattaatga tataatatat      1020
     gaaattaaaa aattgttttt caaaaaatta gaaagagatt tatattgtct gataaacgat      1080
     tgtgatagta ttataaataa aatattagat atattaaaga ctgatggtga aaggaggatg      1140
     cacaaatatt ccttaaagcg cgaaagagta aaacataccg ttatacaagt ttttctcttt      1200
     ttggttttta tgctactttt attcatgcag ctccctgaac aaaattatta caagggtctt      1260
     ctcttgagcc atttcaattt tggtaacaat agcgtctata taaaatatat caaaaacacc      1320
     ggagttatgc tgaacaattg ggaaaattct tatataatga taaatgtcat tttagttttc      1380
     tttttcttgt taagcggtat tatgaaaaag aaattttcga agaatattaa aacgttacat      1440
     gtttcaagca aggaaatctt gagggaacaa ctcacctttg ccaagtttgc aaaagataga      1500
     ggaaagtatt tggcaaaaac tttttacgaa ttaaaacaaa catga                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page