(data stored in SCRATCH zone)

EMBL: AL844507.PE210

AL844507.PE210       Location/Qualifiers
FT   CDS_pept        join(965822..965890,966352..966657)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821400"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.52:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB48"
FT                   /protein_id="CAD51160.1"
FT                   /translation="MTKVNKPPVTVNKIKKPNSKEEEEINQPVKKTLIAKNNNPPTPVN
FT                   KVIKKPDEKVCSSNTDSQKKSDGTDDKSKKDGQGTDKTKGTNSDSKSKNNDDNKSNVQK
FT                   YGYFSWLWKYFQPKKTEVKK"
     atgacaaaag ttaacaaacc gcccgttaca gttaataaaa tcaagaagcc taattcaaaa        60
     gaagaagaag aaataaatca acctgtcaaa aaaacgttaa tcgcaaaaaa taataatcct       120
     cctactcctg taaataaggt tattaaaaaa ccagatgaaa aagtatgttc ttcaaataca       180
     gattcacaaa aaaaaagcga tggcacagat gataaatcta aaaaggatgg ccaaggtact       240
     gataaaacaa aaggcacaaa ttcagatagt aaatctaaaa ataatgatga taataaatcg       300
     aatgtacaaa aatatggata cttctcgtgg ttatggaaat actttcaacc aaaaaaaaca       360
     gaagtcaaaa aataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page