(data stored in ACNUC9543 zone)

EMBL: AL844507.PE211

AL844507.PE211       Location/Qualifiers
FT   CDS_pept        complement(967901..968740)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821500"
FT                   /product="ribosomal RNA small subunit methyltransferase
FT                   NEP1, putative"
FT                   /EC_number="2.1.1.260"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0041:mRNA"
FT                   /db_xref="GOA:Q8IB49"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB49"
FT                   /protein_id="CAD51159.1"
FT                   /translation="MENKQDDENSVNIKESILLSELSDDPNDYDQNNYDQNNYDQNNYD
FT                   QNVYDQNGYDPNDYDDEQRKKKKVIIILEGACLQLIEVKRFIYELANSRKHKNILKKNK
FT                   VDEENIKNFRPDILHQCLIHLLESPLNKFGYLQIYIKTHDNQLFYVSSNLKIPKTFQQF
FT                   ESLMVTFLRKYKIKANEKNIYLLKIIKNDLQNILPINGHKIGLSLKGKKVELNNYIKVY
FT                   KNTNQPVTFFIGAVAYSNPTMKLQILDDNISISDFSLSAAMCCSSICSEFEHLWNLF"
     atggagaaca aacaagacga tgaaaatagt gttaatataa aagaatccat tttgttatca        60
     gaattatcgg atgacccaaa tgattacgat caaaataatt acgatcaaaa taattacgat       120
     caaaataatt acgatcaaaa tgtttatgat caaaatggtt atgatccaaa tgattatgat       180
     gatgaacaaa ggaagaaaaa aaaagtaatt ataattttag aaggagcttg tttacaatta       240
     attgaagtga aacgatttat atatgaatta gctaatagta ggaaacataa aaatatttta       300
     aaaaaaaata aggtggatga agaaaatata aaaaacttca gacctgatat attacatcaa       360
     tgtttaatac atttattaga aagtccttta aataaatttg gatatctaca aatatatata       420
     aaaacacatg ataaccaatt attttatgta tcatcaaatt taaaaatacc taaaacattt       480
     caacaatttg aatctttgat ggtcacattt ttaagaaaat ataaaattaa agcaaatgaa       540
     aaaaatatct atttattaaa aattataaaa aatgatttac aaaacatatt acccataaat       600
     ggacataaaa taggattatc attgaaagga aaaaaagtag aattaaataa ttatatcaaa       660
     gtttataaaa atacaaatca acccgttaca ttctttatag gagctgtagc atattcaaat       720
     cctacaatga aattacagat attagatgac aatattagta tctctgattt tagtttaagt       780
     gctgctatgt gttgttcatc tatatgttca gagtttgaac atttatggaa tttattttaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page