(data stored in ACNUC9543 zone)

EMBL: AL844507.PE212

AL844507.PE212       Location/Qualifiers
FT   CDS_pept        969690..971714
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821600"
FT                   /product="polyribonucleotide 5'-hydroxyl-kinase Clp1,
FT                   putative"
FT                   /EC_number="2.7.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0040:mRNA"
FT                   /db_xref="GOA:Q8IB50"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="InterPro:IPR032324"
FT                   /db_xref="InterPro:IPR038239"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB50"
FT                   /protein_id="CAD51158.1"
FT                   /translation="MANNGNTRLYHLKAYHELRIVTLEKSTKYNEKEECIKIRILSSKN
FT                   IHHKSNERKNPTDNINYSAEIFGKELILDKDYTFGYNEKFSIYTYTGCYIQIKGITLQE
FT                   YESKNNTMKEYVSLCYILDAYRKLAKKKKKIGPRILITGNNNSGKSSVSLLLLNYALKS
FT                   GFKPLYIETDTKASSDKVELNRGPGVISCFKYDNMNNIVSMYPMASLNNINNNINNNNN
FT                   NNNNNNNNSNNVELVNNNNTINVNNNMFDSYMKYSLEYFFGYYDIKEDLNLYYHLNECI
FT                   SSCIYLMFLNNINNESTDLRNYSNEQEHICSSGFILNVPSEADHEIVQNMIDIYNINIV
FT                   IIIDNSFLHYSLKKYYHNINEDQQEYNNVEKENNLIKDRDKKSKQTNRLSEHNLLYDMN
FT                   VFNDKDVNPDMRGSTVFTKNKGEDGFYDDQKNEELKRGNYNNININNNNNNNNYYYNND
FT                   NVNNMYNMMYNNHQEDEEKKNIQIIGMPKFEGVIPSDNNRIKYCRNLWYYNYFSRDINI
FT                   NNYAFKKSHILSFKYSRTNFVKLDTNLAVPLSALPSDCRDIKRENVSVSLYNGNVKNLI
FT                   NCILAVSYSKDFTYVHLINIAALIHVQGIKEVEKTQQKQDNEKDKEKENNNSYVNQDGN
FT                   NTEQHQVDYIFDILCPTYITLKNLPPFFIIPGNIRQMKF"
     atggcaaata atgggaatac ccgactttat catctaaaag cgtatcatga acttcgtatt        60
     gtgactcttg aaaaatctac aaaatataat gagaaggagg aatgtattaa gattcgaatt       120
     ttatcaagta aaaatataca ccataaaagt aatgaaagga aaaatccgac cgataatata       180
     aattatagtg ctgaaatatt tggtaaggaa ttaatattag ataaggatta tacatttgga       240
     tataacgaga agttttctat atatacatat actggttgct atatacaaat aaaaggaata       300
     actttacaag aatatgaaag taaaaacaat acgatgaaag aatatgtatc attatgttat       360
     atattagatg cgtatcgtaa gttagcaaaa aaaaaaaaga aaatcggtcc tagaatattg       420
     ataacaggaa ataataattc tggaaaaagt tcggtatcat tacttttatt aaattatgca       480
     ttgaagtcag gatttaagcc tttatatata gagacagata ctaaagctag ttcagataaa       540
     gttgaattaa atcgagggcc tggggtgatt agttgtttta agtatgataa tatgaataat       600
     atagtaagta tgtaccctat ggcaagtcta aataatatca acaataatat caacaataat       660
     aataacaata ataataacaa taataataac agtaataatg ttgagttagt caataataat       720
     aataccatca atgttaataa taatatgttt gattcgtaca tgaaatattc tctagaatat       780
     tttttcggat attatgatat taaagaagat ctaaacttat attatcatct gaacgaatgt       840
     ataagtagtt gtatatatct catgttttta aataatatta acaacgaatc aactgattta       900
     agaaattata gtaacgaaca agaacatata tgctcctctg gatttatatt aaatgtgcct       960
     tcagaagcag accatgaaat tgtacagaat atgatagata tatataatat taatattgtt      1020
     attattatag ataattcttt tttacattat tcattaaaaa aatattatca taacataaat      1080
     gaagatcaac aggaatataa caatgttgag aaagaaaata atttaatcaa agatcgagat      1140
     aaaaaaagta aacaaacgaa taggttatct gaacacaatt tattatatga tatgaatgtt      1200
     tttaatgata aagatgtgaa tcctgatatg cgcggttcaa ctgtttttac caagaataag      1260
     ggtgaagatg gtttttatga tgatcagaaa aatgaagaat taaaaagagg aaattataat      1320
     aatataaata taaataataa taataataat aataattatt attataataa tgataatgtg      1380
     aataatatgt ataacatgat gtataataat catcaagaag atgaagaaaa aaaaaatatt      1440
     caaataattg gcatgcccaa attcgaaggg gttattcctt ccgataataa tcgtataaaa      1500
     tattgtagaa atttatggta ttataattat ttttcaagag atataaatat aaataattac      1560
     gcttttaaga aaagtcatat actatccttc aaatatagta gaacgaattt tgtaaaatta      1620
     gatacaaatc tagccgtacc tttatcggct ttaccatctg attgtagaga tataaaaaga      1680
     gaaaatgtat ccgttagtct atataatgga aatgttaaaa acttaataaa ttgtatttta      1740
     gcagtatctt attcaaaaga ttttacatat gtacatctta ttaatatagc tgcattaatt      1800
     cacgtgcagg gtattaaaga agtcgaaaaa acacaacaaa aacaagataa cgaaaaggac      1860
     aaagaaaagg aaaataataa ctcttatgtt aatcaagatg gaaataatac tgaacaacat      1920
     caagttgatt atatttttga tatattatgt ccaacatata taacattgaa aaatttacct      1980
     ccatttttta taatacctgg aaatataagg caaatgaaat tctaa                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page