(data stored in ACNUC9543 zone)

EMBL: AL844507.PE213

AL844507.PE213       Location/Qualifiers
FT   CDS_pept        join(973586..973765,973866..973997,974160..974267)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821700"
FT                   /product="60S ribosomal protein L22, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821700"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0039:mRNA"
FT                   /db_xref="GOA:Q8IB51"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="PDB:3J79"
FT                   /db_xref="PDB:3JBN"
FT                   /db_xref="PDB:3JBO"
FT                   /db_xref="PDB:3JBP"
FT                   /db_xref="PDB:5UMD"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB51"
FT                   /protein_id="CAD51157.1"
FT                   /translation="MVAKKDSTKVSKKLKKKVVKKTKIVKGLKKQKMNKSTKGIKYVLD
FT                   CTKPVKDTILDISGLEQFFKDKIKVDKKTNNLKNKVVVTSDEYKIYITVHIPFSKRYIK
FT                   YLAKKYIKMHQIRDFLRVIAKGKLAYEFKYFQLNN"
     atggtggcta aaaaagatag tacaaaagtt tccaagaagc tcaagaaaaa agttgtaaag        60
     aaaacaaaaa ttgttaaggg tttgaaaaaa caaaagatga acaagagtac taagggaatt       120
     aaatatgttt tggattgtac caagcctgta aaggatacaa ttttagatat aagcggattg       180
     gaacaatttt tcaaggataa aattaaagtt gataagaaaa caaataactt gaaaaataaa       240
     gttgtagtaa catctgatga atataaaatt tatatcaccg tccacatacc cttttctaaa       300
     agatacataa agtatttggc aaagaagtat ataaagatgc accaaatacg tgacttctta       360
     agagttatag ctaaaggaaa attagcctac gaatttaaat actttcaatt aaataattaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page