(data stored in ACNUC9543 zone)

EMBL: AL844507.PE215

AL844507.PE215       Location/Qualifiers
FT   CDS_pept        complement(join(977432..977539,977712..977769,
FT                   977890..977975,978117..978188))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.50:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W7"
FT                   /protein_id="CAX64145.1"
FT                   /translation="MIKLFQINKRFIYWPPKNKLRTLRFPSGKKSFIFVGKRDEDGKEE
FT                   PVLCFVDNQNQKLTWMNEEEVLNFEKLMPRLDSYFSLYIQKAQKVNEQNMQLIEEMHKT
FT                   YHE"
     atgataaaac tatttcaaat taacaagcgc tttatttatt ggccacctaa aaataaatta        60
     aggacattaa ggttcccatc agggaaaaaa agtttcattt ttgtgggtaa gagagacgag       120
     gatggtaaag aagaaccagt attatgtttc gtcgataacc aaaatcaaaa attgacgtgg       180
     atgaatgaag aagaagtttt aaatttcgaa aaattgatgc caagattgga cagctatttt       240
     tctttatata tacaaaaagc acaaaaagta aatgaacaaa atatgcaact aattgaagaa       300
     atgcacaaaa catatcatga gtaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page