(data stored in ACNUC9543 zone)

EMBL: AL844507.PE216

AL844507.PE216       Location/Qualifiers
FT   CDS_pept        join(978798..980376,980507..980634)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822000"
FT                   /product="ribosomal protein L4, mitochondrial, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0038:mRNA"
FT                   /db_xref="GOA:Q8IB54"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB54"
FT                   /protein_id="CAD51154.1"
FT                   /translation="MHLTNKLTKNISFFYHVPLFQKRKLTTFALRKKYIWKNNTHTKKN
FT                   DEKKIMTCSGDFIEKKKKNYEWEIERKEEEEEEEEEQDEECSENDIEVMNKEVACNINN
FT                   DIKIKENNKINVDDDISVCDEYKFLFERPKHFAHIDDEPIIRRPGCIIDIKTLLRNNWS
FT                   FPAVGFNSKLEIPIYKFEADENDDNIKYISVPNDIFGLPIRSDILHKCYYFYRTALAGY
FT                   TERMQLYKWEWPGSTKKYRSQKKSGKARMNWRKTCGRYLGVKNHPIRPFDQKTNINRKF
FT                   LWKGMKILLSAKFAQDQIKVVDNFLIKSHKTKYTVKYLRNILGKNCNSALLVHEGKTDV
FT                   NDNFLWACANIASVKRENVEGVNIYNLLKYRYVVFTYKALKNIIYELKIYPYKMKWLPT
FT                   YATPNNTQAPIPEKVKNWNFLWLEKKKRNNFSKFDKETLKKRIQEWKWSSDIKGALKVK
FT                   KHDPYKNFILTKFQCNDPVPEYIKYEYLFNVDDDPHEDNDYEEHFHMLDEILNDDEDLP
FT                   TISSLSSLQGLEKDDNVQSEEHYEDDIYNDEGVNDINEDELGNINFEDTKD"
     atgcatttaa caaataaact gacaaagaat atttcctttt tctatcatgt tccattattt        60
     caaaaaagaa aattgacaac tttcgcttta aggaaaaaat atatatggaa aaataataca       120
     cacacaaaaa aaaatgatga gaaaaaaatt atgacttgtt caggtgattt catagaaaaa       180
     aaaaaaaaaa attatgaatg ggaaattgaa aggaaagaag aagaagaaga agaagaagaa       240
     gaacaggatg aagaatgttc ggaaaatgac attgaagtta tgaataaaga agtagcatgt       300
     aatattaata atgatattaa aattaaagag aataataaaa taaatgtgga tgatgatata       360
     tccgtatgtg atgaatataa atttcttttt gagagaccaa aacattttgc tcatattgat       420
     gatgagccaa ttatcagaag acctggatgt attattgata taaaaacatt attaagaaat       480
     aattggagtt ttcctgctgt tggttttaat agtaaattag aaattccgat atataaattt       540
     gaagcagatg aaaacgatga taatataaaa tatataagtg ttccgaacga tatttttgga       600
     ttaccaataa gatcagatat attacataaa tgttattatt tttataggac ggctttagct       660
     gggtatactg aaagaatgca attatataaa tgggaatggc caggtagtac taaaaaatat       720
     cgaagtcaaa aaaagagtgg taaagcaaga atgaattgga gaaaaacatg tggtagatat       780
     ttaggtgtga aaaatcatcc tataagacct tttgatcaaa aaactaatat aaataggaaa       840
     tttttatgga aaggtatgaa aatattatta tcagcaaaat ttgctcaaga tcaaataaaa       900
     gttgttgata actttttaat taaatctcat aaaacaaaat atactgtaaa atatttaaga       960
     aatattctag gaaagaattg taatagtgct ttgctagttc atgagggaaa aacagatgtg      1020
     aatgataatt ttttatgggc atgtgctaat atagcaagtg taaaaagaga aaatgtggaa      1080
     ggagttaata tttataattt attaaaatat agatatgttg tgttcacata taaagcttta      1140
     aaaaatatta tatatgaatt aaaaatttat ccatataaaa tgaaatggct acctacctat      1200
     gcaactccta ataataccca agcaccaata ccagaaaaag tgaaaaactg gaatttttta      1260
     tggttagaaa aaaaaaaaag aaacaatttt tccaaatttg ataaagagac attaaaaaaa      1320
     agaattcaag aatggaaatg gtcaagtgat ataaaaggtg ctctaaaagt caaaaagcat      1380
     gatccatata aaaattttat tctcaccaaa tttcagtgta atgatcctgt accagaatat      1440
     ataaaatatg aatatttatt taatgtggat gatgaccctc atgaggataa cgattatgag      1500
     gaacactttc acatgcttga tgaaatattg aatgatgacg aggatttacc tactatatca      1560
     agtttgtctt ctttacaagg tttagaaaag gatgataatg tacaatctga ggaacactat      1620
     gaagatgata tatacaatga tgaaggtgtg aacgatataa atgaagacga attaggaaac      1680
     attaatttcg aagatacaaa ggattaa                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page