(data stored in ACNUC9543 zone)

EMBL: AL844507.PE22

AL844507.PE22        Location/Qualifiers
FT   CDS_pept        complement(167069..170434)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802300"
FT                   /product="periodic tryptophan protein 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0130:mRNA"
FT                   /db_xref="GOA:Q8IAM3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027145"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM3"
FT                   /protein_id="CAD51340.1"
FT                   /translation="MLNYTLSNICGCFYTGGKILFSNDGNSLFVPVSNRINIYDLSNNS
FT                   CNTLKSESRNDIRHITIHPSMEIIITIDKFGYGCVINLLKDQIISRILFKSKTGVVTSF
FT                   NYNNMLTPQEEQDVVNSAMFTNSGKYFLITVGRRVVIWKSPCKQNNYKLIKYNDICFHS
FT                   LNVISIDISTDDKYFLTTSYDMTIRIHTVKKEKKIKPTILGGNKTTIVGAFFSKNGNFI
FT                   FSVNKSGLIIIWSYEAQTGVDEKCENFEAEKVYEDVSRDDNKGDEDVSMDDNKGDEDVS
FT                   RDDNKSDEDVSRDDENISSDNEKKKNRKEEKWSKICAHDNKIKDNTNKNKNNNHHNNNN
FT                   NNNDYFNSSVKRAFEKRWRYKRIYYCNQEKNEEVIRSCFNKEKDIFVIAFSSGRFGIYS
FT                   TPDMISLYNISINTNTIDDITINTDGEWIALGEGNNGTIIIWEWKSESYILKQNTTNKN
FT                   VKCVRFSPIISHLKIGSHIIDNSSTYHESDNFTSKFVIVTGNEDGTIKLYDYLSFINFV
FT                   TFTAHTNTVTDICFLPQGNAFISCSLDGTVRAFDLLRYRNFKIYTPDVITDLNHYSNNM
FT                   NDLNSSGKKKVDKKLNVQFLCVGVNISGNIVAAGGRGNEYVVYIWNVQTGKCIDKLFGH
FT                   NSPIIKICFSTNLKNEGVIASCSWSKNVLIWDLYARQNKGSKYEEITTSHDISYMCFDP
FT                   RGNDILAVCTLSCKIMFWDISIQEVVGTIEGARDIKRGRLLGEQFGAIPKMNKKRNRKK
FT                   SLNNVDEESMYEEDLEDQGNNTIVNQNCYFTSIDYIHNGNYIVGCANCSVSLYIYDTNL
FT                   YLLIKIIDLTKNYCVDGIKREISTRYLTSEGTHIYELDISDEEGDIYLDNYKIMNRKKK
FT                   QNLLPGQINEDYLNSKLKKYKFLLNQLHISGDDRHIAVACNTGLYVFTKDYQYQYIPSI
FT                   KNIYKGLISPNIYVPKFLTQNVNLNNLKNSLKKKEYMKAFILSLALNNYENILEVYENI
FT                   PYNIIPLCVKVLTKPFLFILINFIKTLLINDTIKHIHLHLFYLNSLFTTHFNVFLNNDF
FT                   YNHMNNNKSIKNSQDKIKTSTQNVMSNTSSLFSSDEIRTSLLLILKQIFTINNGLQYLY
FT                   SNNINVLKYLSLKE"
     atgttaaatt atacgttgag caacatatgt gggtgttttt atactggagg gaaaatatta        60
     tttagtaatg atgggaactc tttatttgta cctgtaagta atagaataaa tatttacgat       120
     ttaagtaata atagttgtaa tacattaaaa tcagagagtc gtaatgatat aagacatatt       180
     actattcatc ctagtatgga gattattata acaatagata agtttggtta tggttgtgtt       240
     ataaatttat taaaagatca gataatatca agaatattgt ttaaatccaa aacaggtgta       300
     gttacttctt ttaattataa taatatgctt actcctcaag aagaacaaga tgttgttaat       360
     tcagcaatgt ttacgaattc tgggaaatac tttttgataa cagttggtag acgagtagtt       420
     atttggaaaa gtccatgtaa acaaaataat tataaattaa taaaatataa tgatatatgt       480
     tttcattcct taaatgttat atctatagat atatcaacag atgataagta ttttttaact       540
     acctcgtatg atatgactat aagaattcat acggttaaaa aagaaaaaaa aatcaagcca       600
     accattttgg gtggaaataa aacgaccatc gtgggtgcct tcttttcaaa aaatgggaac       660
     tttatattta gtgtaaataa atctgggcta ataattattt ggtcctatga agcccaaacg       720
     ggggtagacg aaaaatgtga aaattttgag gccgaaaaag tgtatgagga tgtgagtagg       780
     gatgataaca agggtgatga ggatgtgagt atggatgata acaagggtga tgaggatgtg       840
     agtagggatg ataacaagag tgatgaggat gtgagtaggg atgatgaaaa tatttcatct       900
     gataatgaaa aaaaaaaaaa tagaaaagag gaaaagtgga gtaaaatatg tgcgcatgat       960
     aataaaataa aagacaacac caacaaaaac aaaaacaata atcatcataa taataataat      1020
     aataataatg attattttaa tagtagtgtg aagagagctt ttgaaaagag gtggcggtat      1080
     aaaagaatat attactgtaa tcaagaaaag aatgaagaag ttataagatc atgttttaat      1140
     aaagaaaagg acatatttgt tatcgctttt tctagtggaa gatttggtat ttatagtact      1200
     ccagatatga tttctcttta taatataagt attaatacaa atacaattga tgatattact      1260
     ataaatactg atggagagtg gatagcttta ggagaaggta ataatggtac tattataata      1320
     tgggaatgga aaagtgagag ctatatatta aaacaaaata caacaaataa aaacgttaaa      1380
     tgtgttagat tttctcctat tattagtcat ttaaaaattg gtagtcatat tatagataat      1440
     tcaagtactt atcacgaatc tgataatttt actagtaaat ttgttattgt tacaggtaat      1500
     gaagatggta ctattaaatt atatgattat ttatccttta ttaattttgt tacatttact      1560
     gctcatacga atacagttac cgatatttgt tttttaccac aaggaaatgc attcatctca      1620
     tgttctcttg atggtactgt tagagctttt gatcttttaa gatatcgtaa ttttaaaatc      1680
     tatactccgg atgttattac agatttaaat cattatagta ataatatgaa cgacctgaac      1740
     agttcaggta aaaaaaaagt ggataaaaaa ttgaatgttc aatttttgtg tgtgggtgtg      1800
     aatataagtg ggaatatagt agcagcaggt ggtcgtggga atgaatatgt ggtatatata      1860
     tggaatgtgc agacagggaa atgtatagat aaattatttg gtcataattc tcctataata      1920
     aaaatatgtt ttagtacgaa tttaaaaaat gaaggagtaa tagctagttg ttcatggagt      1980
     aaaaatgtat taatatggga tttatatgca cgccaaaata agggtagtaa atatgaggaa      2040
     ataacaacat cacatgatat atcatatatg tgttttgatc ctcgaggaaa tgatatatta      2100
     gctgtatgta cattaagttg taaaattatg ttttgggata tatctataca agaagttgta      2160
     ggaactatcg aaggagcaag ggatatcaag agaggtagat tattaggtga acagtttggg      2220
     gcaataccaa aaatgaataa aaaaaggaat aggaaaaaaa gtttgaataa tgtagatgaa      2280
     gaatctatgt atgaagaaga tttagaagat caaggaaaca atactattgt aaatcaaaat      2340
     tgttatttta catctataga ttatatacat aatggtaatt atatagttgg atgtgctaat      2400
     tgtagtgtct ctttatatat atatgataca aatttatatt tattaataaa gattattgat      2460
     ttaacaaaga attattgtgt agacggtatt aaaagagaaa tatccactcg atatttaaca      2520
     tctgaaggga cacatatata tgaattagat attagtgatg aagaaggtga tatttattta      2580
     gataattata aaattatgaa tagaaagaaa aaacaaaatt tattaccagg acaaattaat      2640
     gaagattatt taaatagtaa attaaaaaaa tataaattcc ttttaaatca attacatata      2700
     tctggtgatg acaggcatat agctgttgca tgtaatactg gattgtatgt attcacaaaa      2760
     gattatcaat atcaatatat tccaagtatt aaaaatattt ataaaggatt aatatcacct      2820
     aatatatatg ttccgaaatt tttaacacaa aatgttaatt taaataattt aaaaaattct      2880
     ttaaaaaaaa aagaatatat gaaagccttt attttatctt tagcattaaa taattatgaa      2940
     aacattttag aggtatatga aaatatacca tataatatta taccactatg tgtaaaagta      3000
     ttaaccaaac cttttttatt tattctcata aattttataa aaacattatt aattaatgat      3060
     accatcaaac atatccattt acatttattt tatcttaatt ccttatttac aactcatttt      3120
     aatgttttct taaataatga tttttataat catatgaata ataataaatc tattaagaac      3180
     agtcaagata aaattaaaac atctacccaa aatgttatga gtaataccag ttcacttttc      3240
     tcatcggatg aaatacgcac atccctttta ttaatattaa aacagatctt tactataaat      3300
     aatggtttgc agtatttgta tagtaataac ataaatgtct taaagtattt atctttaaag      3360
     gaatga                                                                 3366
//

If you have problems or comments...

PBIL Back to PBIL home page