(data stored in ACNUC9543 zone)

EMBL: AL844507.PE222

AL844507.PE222       Location/Qualifiers
FT   CDS_pept        join(997055..997354,997550..999529)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822600"
FT                   /product="protein transport protein SEC23"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822600"
FT                   /db_xref="GOA:Q8IB60"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036174"
FT                   /db_xref="InterPro:IPR036175"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037364"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB60"
FT                   /protein_id="CAD51148.1"
FT                   /translation="MDIHAQENQTGIRFSWNLWPPTKAEAAKIEVPLGCLYTVLKRTDD
FT                   SSVKLVEYEPLKCKTSNCILNPYCNIDFRNKTWTCPFSNIKNPFPLHYAEHISEKNLPA
FT                   DVMYSNIEYIQPSNVGDIPPPTFLFVIDTCLLEEELEQLKDSIQQCISLMPGDAYIGII
FT                   TFGNMCYVHEIGFNDCLKSYVFKGNKEISAQDLQKQLNLGSRNDPRSSTTSASARRFLQ
FT                   PVSECEYNINMLLEDIQKDNWPTPPDQRAKRCTGVALSVAIGLLECCCNQLSGRVMMFI
FT                   GGADTTSPGKIVDTPLSESLRHHLDLQKENSNARHVKKALKYYVSLANRAVASGHAIDI
FT                   FACSLDQIGLYEMKVCCEKTNGFMVMADSFSMNVFKDSFKKIFETDSTEYIKHGYNAKL
FT                   TVICSKEFRVCGAIGACSSNKKTANYVSDTCVGEGGTCEWTICALDRQSTIAFYFEIVN
FT                   QNLASLPPDRQAYLQFQTLYQHPSGRRRLRVTTISYRFAEPNIAEISQGFDQETAAVIM
FT                   ARFAVLKAETDEPIDVLRWLDRKLIRLVSTFADYQKDDINSFHLSSEFSIYPQFMYHLR
FT                   RSHFLQTFNASPDETAYYRSILLRENVMNSLIMIQPALLQYSFDSPTPIPVLLDAQSLK
FT                   SNVILLLDSYFHIVIWYGEMIYQWREQGFHEKPEYEHFRQLLNAPHEDAKSILEDRFPI
FT                   PKFVLCNSGGSQSRFLLAKVNPSTTHNSLSGSTFGTSSNESYIINTDDVSLKIFMDHLV
FT                   KLAVQT"
     atggatatac atgcacaaga gaatcagacg ggtattcgtt ttagctggaa cttatggcca        60
     cccacaaaag cagaagcagc aaaaatagaa gtacccttag ggtgtttata tacagtatta       120
     aaaaggacag atgatagtag cgttaagtta gtagaatatg agcctttaaa atgtaaaact       180
     agtaattgta ttttaaatcc ttattgtaat attgatttta gaaataagac atggacatgt       240
     cctttctcaa atatcaagaa tccatttcct ttacattatg cagagcatat atcagagaag       300
     aatttgcctg ccgatgttat gtactccaat attgaataca tccaaccttc caatgtagga       360
     gatattcccc ctccaacgtt tttattcgtc atcgatactt gtttactaga agaagagcta       420
     gaacaattaa aagattcaat tcaacaatgt attagtttaa tgcctgggga tgcttacata       480
     ggtataatta cttttggtaa tatgtgttat gttcatgaaa ttggttttaa cgattgtttg       540
     aaatcttatg tatttaaggg gaataaagaa ataagtgctc aagatttaca aaaacaatta       600
     aatttaggta gtagaaatga tcctcgtagt tccacaacat ctgcttctgc tcgtcgattt       660
     ttacaacccg ttagtgaatg tgaatataat ataaatatgt tattagaaga tatacaaaaa       720
     gataactggc caactccacc agatcaaaga gctaaaagat gtaccggtgt agcattgagt       780
     gttgctattg gtttattaga atgttgttgt aatcaattaa gtggtcgtgt tatgatgttt       840
     ataggtggag cagatactac ttcccctggt aaaattgtag atacgccttt aagtgaatcg       900
     ttaagacatc atttagattt acaaaaagaa aattcgaatg ctagacatgt taaaaaagct       960
     ttaaaatatt atgtatcact agctaataga gctgtagcat ctggtcatgc tattgatata      1020
     tttgcatgtt cattagatca aataggttta tatgaaatga aggtttgttg tgaaaagaca      1080
     aatggtttta tggttatggc agattcattt tctatgaatg tatttaaaga ttcttttaaa      1140
     aaaatatttg aaacggattc gacggaatat ataaaacatg gttacaatgc aaaattgacg      1200
     gttatttgtt caaaagaatt tagagtatgt ggtgcaatcg gtgcatgttc aagtaataaa      1260
     aaaacagcta actatgtatc tgatacgtgt gttggagaag gtggtacatg tgaatggact      1320
     atatgtgcat tagatagaca atcaacaatt gctttttatt ttgaaatagt aaatcagaat      1380
     ttggcttcct tacctccaga tagacaagcg tatttacaat tccaaacatt atatcagcat      1440
     cctagtggaa gaagaagatt acgtgttact acaatatctt atagatttgc agaacctaat      1500
     atagcagaaa tatcgcaagg ttttgatcaa gaaactgctg ctgttattat ggctcgattt      1560
     gctgtattaa aagcagaaac agatgaacct atagatgtat taagatggct tgatagaaaa      1620
     cttattagat tagttagtac ttttgcagat tatcaaaaag atgatattaa ttcttttcat      1680
     ttatcttccg aattttctat atatcctcaa tttatgtatc atttaagaag atctcatttt      1740
     ttacaaacgt ttaatgcaag tcctgatgaa acagcatact atagaagtat attattaaga      1800
     gaaaatgtta tgaattcatt aattatgata cagccagcat tacttcaata ttcatttgat      1860
     tccccaactc caataccagt attattagat gcacaatctt taaaatcaaa tgtaatactt      1920
     ttattagatt catatttcca tatagttata tggtatggag aaatgatata tcaatggaga      1980
     gaacagggtt ttcatgagaa gccagaatat gagcatttta gacaattatt gaatgcacca      2040
     catgaagatg ctaaatccat tttagaagat agatttccta tacctaaatt tgttttatgt      2100
     aatagtggtg gtagtcaaag tagattttta ttagctaagg tgaatccatc aacaacacat      2160
     aattcgttaa gtggtagtac ctttggtaca tctagtaatg aatcttatat aattaataca      2220
     gatgatgttt ctttaaaaat atttatggat catttagtaa agttagcagt acaaacttaa      2280
//

If you have problems or comments...

PBIL Back to PBIL home page