(data stored in ACNUC9543 zone)

EMBL: AL844507.PE223

AL844507.PE223       Location/Qualifiers
FT   CDS_pept        complement(1000981..1003755)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822700"
FT                   /product="thrombospondin-related protein 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.45:mRNA"
FT                   /db_xref="GOA:C0H4X0"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X0"
FT                   /protein_id="CAX64148.1"
FT                   /translation="MYNHFLYFPFEKFLFIFILVVWLAFQTNKRPSYITKKYKIDDVKN
FT                   IDMIIQHDIVINTQNIMCIFYILYINNLDKNKNFIQYKNFKKNKSYKYKNNNNNIIIIN
FT                   SHSHSNSHSNSHSHSNSHSNSHSHSNSHSNSHSHSNSHSHSHSNSHSNSHSHSSTQNSL
FT                   YHDTNQANFLKPTSFFLYKHHVYFNQKYKKDPNILNKLKVPRNHIFHINKCDLNYYIQN
FT                   YEFFFFFPDYYEYSHLYIRLDKLFYFQRCGCDTNIKKTKKRNQNIFNNMLGMKEKDTYL
FT                   QNEICDIYWNYLKDDNTYDKYNFSIINYIKNIIKKMYRYLYIYKVFVLKQFYRIVYYNQ
FT                   GIRNFYYMLFSYIYNKGSIIYNYNQMYFKKHRKKQTIIRSKRFMNEHIKEEDVDYNIVK
FT                   DEKDKSIQSTEQKSYLKNNTIQYFQCFLDKAMENKNAENELDKWIDPQSKSCYCSEEFA
FT                   EPCTSEDLVDINNINQIMDNAFCEYNNNDNNNNDNNKNNNNNINNIINIYDNNILGDNV
FT                   KNIFVALSEYKILQCNDKEKKDIIKKEQLYNYCKYGLNIWDNKNMYDYLNCLNVISYNK
FT                   KDDKTCIRKCENIKKLCNIVAQFYSFEVCKKYYENNKHTEDIYINNFKYFSDHCKYIDP
FT                   TNRGLVLCKHKNVECVYSQWSEWSTCSKTCIENEYDTNSTRTRTRILLNKFEVPSKSCS
FT                   FIINEKNNLMDINFCSYLPFCNKNNDMKKKDDERIMPFVISIKEIEKLNTLKYLNNDDN
FT                   DLLNENYKNYESVHKNNECKVTDMYQYEYAISYNEKNKSCSCPNNQSPCYFKDIYNSES
FT                   WKKSLHILCKHNPHINVITADYIIIDCNMSISIKKKEIAVNTYLAMTFNCHSDIFQYIF
FT                   CAKNIQSIRTNFIYIIITCAFGFISAIYIIHIFINKWHIFKLLLHKQNKKKSY"
     atgtataatc attttttgta ttttcctttt gaaaaatttc tattcatctt tatacttgtt        60
     gtttggttag ccttccagac aaacaaacgt ccgtcctata ttacaaaaaa atataaaatt       120
     gatgatgtaa aaaatattga tatgattatc caacatgata tagtaattaa cacacaaaat       180
     ataatgtgta tattttatat actttatata aataatttgg ataaaaataa aaattttata       240
     cagtacaaaa atttcaaaaa aaataaaagt tacaaatata aaaataataa taataatatt       300
     attattatta atagtcatag tcatagtaat agtcatagta atagtcatag tcatagtaat       360
     agtcatagta atagtcatag tcatagtaat agtcatagta atagtcatag tcatagtaat       420
     agtcatagtc atagtcatag taatagtcat agtaatagtc atagtcatag tagtactcaa       480
     aacagtttat atcatgatac aaatcaggct aattttttga aaccaacttc tttctttctc       540
     tataaacatc atgtttattt taatcaaaaa tataaaaagg atccaaacat tttaaataaa       600
     ttaaaagtac caaggaatca tatttttcac attaataaat gtgatttaaa ttattatata       660
     cagaattatg aatttttttt tttttttcca gattattatg aatattctca tttatatata       720
     agattagata aattgtttta ttttcaaaga tgtgggtgtg acacaaatat taagaaaacg       780
     aaaaaaagaa atcaaaatat atttaataat atgttaggta tgaaggaaaa ggatacatat       840
     ctacagaacg aaatatgtga tatatattgg aattatctta aagatgataa tacatatgat       900
     aagtataatt ttagtataat aaattatata aagaacataa ttaaaaaaat gtacagatat       960
     ttatatatat ataaagtgtt tgttttaaaa caattttatc gtatagtgta ttataaccaa      1020
     ggtattagga atttttatta tatgttgttt tcatatatat ataataaagg gtctattata      1080
     tataattata accaaatgta ttttaaaaaa catcgaaaga aacaaacaat tatacgatca      1140
     aaaagattta tgaatgaaca tataaaagaa gaagatgttg attataatat tgttaaagat      1200
     gaaaaagata aatctataca atcaaccgaa cagaaatcct atttaaaaaa taatactatt      1260
     caatatttcc aatgttttct tgataaagct atggagaata aaaatgccga aaatgaatta      1320
     gataaatgga tagatcctca gagtaaatca tgttactgta gtgaggaatt tgctgaacca      1380
     tgtacatctg aagatcttgt ggatataaat aatataaatc aaataatgga taatgccttt      1440
     tgtgaatata ataataatga taataataat aatgataata ataaaaataa caataataat      1500
     atcaataaca ttatcaatat ttatgataat aatattttgg gtgataatgt gaaaaatatt      1560
     ttcgttgcat tatctgaata taaaatatta caatgtaatg ataaagaaaa aaaggatata      1620
     ataaagaaag aacaattata taattattgt aaatatggtt taaatatttg ggataataaa      1680
     aatatgtatg attatttaaa ttgtttgaat gttataagtt ataataagaa agatgataaa      1740
     acatgtataa gaaaatgtga gaatataaaa aaattatgta atattgttgc gcaattttat      1800
     tcattcgaag tttgtaagaa atattatgaa aataataaac atacagaaga tatatatatt      1860
     aacaatttta aatatttttc tgatcattgt aaatatatag atcctacaaa tagaggattg      1920
     gtattatgta aacataaaaa tgtggaatgt gtttatagtc aatggtctga atggtcaaca      1980
     tgttcaaaaa catgtataga aaatgaatat gatacaaatt caaccagaac acgtacaaga      2040
     attttattaa ataaatttga ggtaccttca aaatcatgta gttttattat aaatgaaaaa      2100
     aataatttaa tggatataaa tttctgttca tatttaccat tttgtaataa aaataatgat      2160
     atgaaaaaaa aggatgatga acgtattatg ccttttgtta tatcaataaa agaaatagaa      2220
     aaattaaata cacttaaata tttaaataat gatgataatg atttattaaa tgaaaattat      2280
     aaaaattatg aatctgttca taaaaataat gaatgtaaag ttacagatat gtaccaatat      2340
     gaatatgcta tatcatataa tgaaaaaaat aaatcatgtt catgtcctaa taatcaatca      2400
     ccatgttatt ttaaagatat atacaattca gaatcttgga aaaaatcatt acatatatta      2460
     tgtaaacata atccacatat aaatgttatt actgctgatt atattataat cgattgtaat      2520
     atgtctataa gtataaaaaa aaaagaaatt gctgtaaata cttatcttgc tatgactttt      2580
     aattgtcatt cagatatatt tcagtatata ttttgtgcaa aaaatattca atcaataaga      2640
     acaaatttta tatatattat tattacatgt gctttcggat ttatttcagc tatatatatt      2700
     atacatatat tcattaataa gtggcatatt tttaaattac tcttacataa acaaaacaaa      2760
     aaaaaatcat actaa                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page