(data stored in ACNUC9543 zone)

EMBL: AL844507.PE225

AL844507.PE225       Location/Qualifiers
FT   CDS_pept        complement(1007777..1011307)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0035:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB63"
FT                   /protein_id="CAD51144.1"
FT                   /translation="MEVLQNMNRMDRRIEEIQNLKNIINNKLNKNVNDDVDGYMRQLVD
FT                   LYLKSQKSKSKNLGSKKGKSNSKIRSVSRKSERKINVGKGIEKMQHYENNDQNNINNKN
FT                   NDNNDNNNYDNNNNNNNDNNNNNNNNDNNNNNNNDNNNNNNNDNNNNNNYDNNSKQSFS
FT                   QKNSSENYDNGSGSDDEEKKNNNYNEENENNTQKKKKKKKKGNKKNKNKNKNKNSDKSE
FT                   TNDEEEVTVEMEEKENIIEQLNEQQNEKLDEQLNEQPNENFDEQPNENFDEQPNENFDE
FT                   QPNENFDEQPNENFDEQPNENFDEQPNENFDEQPNENFDEQPNENFDEQPNENFDEQPN
FT                   ENFDEQPNENFDEQPNENFDEQPNENFDEQPNENSDEQSNNTNKDEPNTSNYVNTENVI
FT                   DQGKGNNSECGNIVEEQNNGDSLDERKEKNMKSAIRFMKESNYEDPHLNACLSDSNIDG
FT                   VNINQNEEELKVKDILSNPFTTSSYNEENEKVSNMEMHSNNIENISNCIQKKKTQINLN
FT                   NVLKELKFKSANNIKYGRDNNFDDITEKYINDGSDDLETYKKNSSINDEEPYHYTNFVK
FT                   HYVTKVGIYNNMEKNKLNFNVPSQSYGINHLYNMNKNSYDTNSFQYNKSYSSTTNEEQE
FT                   KDKREYGFNNCMNYTNINCSNINQSYSNMIRNYNTMVNDHNINCTKTNINCTNPKLDCL
FT                   SKSFSKIRKINLCNSAYYPHCTYSNPLKSIKKYSCTNTKNYINEYNCTKNATSMLPDFS
FT                   CMNGVEIMKKHINIDNIKKHVNLENVKKNMDLKNVKKLINLENIKNKINFENVKERVNI
FT                   KNVTDHINIESISKNVECFDNNYYDIFEEAYKNYINKYVNNVKNTIKEKKEYYKKNVNC
FT                   NYELINKNLLKVAANNINNLNNMYLKNKSKLQGLNTKKYIAFNHNKYVRFLNSCYEKKM
FT                   NSVKKKIELNKKFLNNYFHACYFECSDNPMLSNDISRVSSCPEYQNSNEQYHQKQSSMT
FT                   NSINSKSNIYNNSSSHKLLNTEKKKNTSNDSEQINNNLSFPNSNKEFNSNSEIDISCFN
FT                   NGVKTFKYMKGIFEDSGGAENEIIYDQEKNMYFDLNDNAYINVKGNLYFNTKDKLFYDI
FT                   EYIKDISYDNVKNNLFHFGNYLITEKYAPCKIIMKMCAHINQFMYNLLGVAKYDIYYKH
FT                   KDNLVEIIIK"
     atggaagttt tacaaaacat gaatcgtatg gataggcgca ttgaggaaat tcaaaacctc        60
     aaaaatatta ttaacaataa attgaacaaa aatgtaaatg atgatgttga tggttacatg       120
     aggcaattag ttgatttata tttaaaatct cagaaatcta agagcaaaaa tttgggtagt       180
     aagaaaggga aaagcaattc aaaaattaga tctgtgtcta gaaagagtga aaggaaaata       240
     aatgtaggaa aaggaatcga gaaaatgcaa cattatgaaa ataatgacca gaacaacata       300
     aataataaaa ataatgataa taatgataac aacaattatg ataataataa taataataat       360
     aatgataaca ataataataa taataataat gataacaata ataataataa taatgataac       420
     aataataata ataataatga taacaataat aataataatt atgataataa ttctaaacaa       480
     agcttcagtc aaaaaaacag cagcgaaaat tatgataacg gatcaggaag tgatgatgaa       540
     gaaaaaaaaa ataataatta taatgaagaa aatgaaaaca acacacagaa aaaaaagaaa       600
     aagaaaaaaa aaggaaacaa aaagaataaa aataaaaata aaaataaaaa ctctgacaag       660
     tccgaaacga atgatgaaga ggaagttact gtagaaatgg aagaaaagga gaacatcatt       720
     gaacaattaa atgaacaaca aaatgaaaaa ttagatgaac aattaaatga acaaccaaat       780
     gaaaattttg atgaacaacc aaatgaaaat tttgatgaac aaccaaatga aaattttgat       840
     gaacaaccaa atgaaaattt tgatgaacaa ccaaatgaaa attttgatga acaaccaaat       900
     gaaaattttg atgaacaacc aaatgaaaat tttgatgaac aaccaaatga aaattttgat       960
     gaacaaccaa atgaaaattt tgatgaacaa ccaaatgaaa attttgatga acaaccaaat      1020
     gaaaattttg atgaacaacc aaacgaaaat tttgatgaac aaccaaacga aaattttgat      1080
     gaacaaccaa atgaaaattt tgatgaacaa ccaaatgaaa attctgatga acaatcaaat      1140
     aacacgaata aggatgaacc aaatacatct aattatgtga acacggaaaa tgttatagat      1200
     caaggaaaag gaaacaattc agaatgtgga aacattgtag aagaacaaaa taatggagat      1260
     tctttagatg aacgtaaaga aaagaatatg aagagtgcca taagatttat gaaggaatct      1320
     aattatgaag atcctcattt aaatgcttgt ctgtcagata gtaatataga tggtgtgaat      1380
     ataaatcaaa atgaagaaga attaaaagta aaagatatat taagtaaccc atttacaacg      1440
     agtagttaca atgaagaaaa tgaaaaagtg tctaatatgg aaatgcattc taataatatt      1500
     gaaaatatta gtaattgtat tcagaaaaag aaaacacaaa tcaatttaaa taatgtattg      1560
     aaagaattaa aattcaaaag tgcaaataat ataaaatatg gaagagataa taattttgat      1620
     gatataacag aaaaatatat aaatgatggt tcagatgatt tagaaacata taaaaaaaat      1680
     agctcaataa atgatgaaga accttatcat tatacaaatt ttgttaaaca ttatgtaaca      1740
     aaagttggta tatataataa tatggaaaaa aacaaattga attttaatgt cccatcacaa      1800
     tcctatggta ttaatcatct ttataatatg aacaaaaact cttatgatac taattctttt      1860
     caatataaca aatcttattc atccacaact aacgaagaac aggaaaagga taaaagagaa      1920
     tatggattta ataattgcat gaattataca aatatcaact gttctaatat aaaccaaagt      1980
     tattcaaaca tgatcagaaa ttataacaca atggtaaatg atcataacat aaattgtaca      2040
     aaaacaaata taaattgtac aaatcccaaa ctagattgct tatccaaatc attctctaaa      2100
     attagaaaaa ttaacctttg taattcggcc tactatccac attgtactta tagcaaccca      2160
     ttaaaatcta tcaaaaaata ttcttgtaca aataccaaaa attatataaa cgaatataat      2220
     tgtacgaaaa atgctacatc catgcttcca gacttttcat gtatgaatgg agttgaaatt      2280
     atgaaaaagc acataaatat cgataatata aaaaaacatg taaaccttga aaatgtaaaa      2340
     aaaaacatgg atttaaaaaa tgtgaaaaaa cttataaatt tagaaaatat aaaaaataaa      2400
     ataaattttg agaatgtgaa agaacgtgta aatataaaaa atgtaacaga tcatattaat      2460
     atagagagta tatctaaaaa cgttgaatgt tttgataata attattatga tatttttgaa      2520
     gaagcatata aaaattatat taacaaatat gtaaataatg ttaagaatac aattaaagaa      2580
     aaaaaagaat attataaaaa aaacgttaat tgtaattatg aattaattaa taaaaatctc      2640
     cttaaggttg cagcaaacaa tattaataat ttaaataata tgtatttaaa aaataaatca      2700
     aaattacaag gattaaatac caaaaaatat attgcattta atcataataa atatgttcga      2760
     ttcttgaatt catgttatga aaaaaaaatg aattcagtaa aaaaaaaaat tgaattaaat      2820
     aaaaaattcc ttaataacta tttccatgca tgttattttg aatgttcaga taatccaatg      2880
     ttatctaatg atatatctag agtatcttca tgtccagagt atcaaaattc aaatgaacaa      2940
     tatcatcaga agcaatcatc tatgacaaat tcaattaatt caaaatctaa tatatataac      3000
     aactctagtt cacataaatt attaaacaca gaaaaaaaaa aaaatacaag taacgattca      3060
     gaacaaatca acaacaattt atcttttccc aattcaaaca aagaatttaa tagtaattca      3120
     gaaattgata tctcctgttt taataatggt gtaaaaacat ttaaatatat gaaagggatt      3180
     tttgaagatt caggaggagc agaaaatgaa ataatttatg atcaagaaaa aaatatgtat      3240
     tttgatttaa atgataatgc atatattaat gttaaaggga atctttattt taatacaaaa      3300
     gataaattat tttatgatat agaatatatt aaagatattt cttatgataa tgtcaaaaat      3360
     aatctattcc atttcggaaa ttatctcatt acagaaaaat atgcaccatg taaaataatt      3420
     atgaaaatgt gtgctcatat taatcaattt atgtataatt tattaggagt agcgaaatat      3480
     gatatatatt ataaacataa ggataactta gttgaaatta taattaaatg a               3531
//

If you have problems or comments...

PBIL Back to PBIL home page