(data stored in ACNUC9543 zone)

EMBL: AL844507.PE227

AL844507.PE227       Location/Qualifiers
FT   CDS_pept        complement(join(1018089..1018144,1018265..1018421,
FT                   1018556..1018723,1018823..1018932,1019070..1019268))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823100"
FT                   /product="RWD domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.41:mRNA"
FT                   /db_xref="GOA:C0H4X2"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR040213"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X2"
FT                   /protein_id="CAX64150.1"
FT                   /translation="MDYKSEQQSEKESLSLLYECTNEYISLGDNSFKIFIDNKLKKISF
FT                   YILFEYTEKYPDEAPLYKIVDVKNLSISLIKNVENQIQETIENNLGYSMIYNIVENIRT
FT                   YLSEDIEEKSMYDEMIERQPKSNKINDSDNSSDDSEKDLDNYENVLELKELCEEKYRVS
FT                   EEEFEAWRKEFYKDIFLQMKKNNNSENPTGRELFEKEKISILDPEFDEGEPKWCNEELF
FT                   CDIDLDD"
     atggactata aatctgaaca acaatccgaa aaagagagcc tgtcactttt atatgaatgc        60
     actaacgaat atatctcctt gggtgataac tcctttaaga tatttataga taataaattg       120
     aaaaaaattt ccttttatat tttattcgaa tatacggaaa aatatcctga tgaggctcct       180
     ttgtataaaa tagttgacgt taaaaattta tcaatatcct taataaagaa tgtagagaat       240
     caaattcaag agaccataga aaataaccta ggatatagca tgatatataa tatagtggaa       300
     aacataagga cttatctctc tgaagatatt gaagaaaagt ccatgtacga tgaaatgatt       360
     gaaagacaac ccaaatcaaa taaaattaat gatagtgata attcatcaga tgatagtgaa       420
     aaagatttag ataattatga aaatgtattg gagctaaaag aattatgtga agaaaagtat       480
     agagtaagtg aagaagaatt tgaggcatgg agaaaagaat tttataaaga tatattttta       540
     caaatgaaaa aaaataataa ttcagaaaat ccaacaggaa gagagctttt tgaaaaggag       600
     aaaattagta tattagatcc tgaatttgat gaaggtgaac caaagtggtg taatgaagaa       660
     ttattttgtg atatcgatct agatgattaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page