(data stored in ACNUC9543 zone)

EMBL: AL844507.PE228

AL844507.PE228       Location/Qualifiers
FT   CDS_pept        complement(join(1022629..1022985,1023096..1023539,
FT                   1023787..1023846))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823200"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.40:mRNA"
FT                   /db_xref="GOA:Q8IB66"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB66"
FT                   /protein_id="CAD51141.1"
FT                   /translation="MSLTNSSKIFIGSIPKDVTEEELKTEAAKYGTITQVYYVPATAQS
FT                   PRGWAFITYEQRSEAYKAIEALDYKCIFPNSQRPLDVRFASYKYNNSNDAQGGNKNVWQ
FT                   KHVTTDGHPYYYNSVTGHSQWEKPKEMSATNFPGKGSAPSFGPPGANVFVFHLPSHWTD
FT                   MELYQHFQHFGYVVSARIQRDANGRNKGYGFVSFNNPESALNAIKGMHGFYVSGKHLKV
FT                   QLKKGEEHYVQMNTPAQPQLTPAQPYSVQQPIIGNHHQPYMTHLMYGGMDSPNQMRYNT
FT                   YSISR"
     atgtcattaa caaattcaag taaaattttt attggaagta tacctaaaga tgtaacggag        60
     gaagagctaa aaactgaggc agcgaagtat ggtaccataa cacaagttta ttacgtacca       120
     gctacggctc agagtccaag aggatgggca tttattacat acgagcaaag gtctgaggca       180
     tataaagcaa ttgaagcttt agactataaa tgtatttttc caaatagtca aaggccatta       240
     gatgtaagat ttgcaagtta taaatataat aattcaaatg atgctcaagg aggaaataaa       300
     aatgtatggc aaaaacatgt gacaacagat ggtcatccat attattataa ttcagtaaca       360
     ggacattcac aatgggaaaa accaaaagaa atgtccgcaa ccaattttcc tggaaagggt       420
     tcagcaccct cctttggtcc accaggggca aatgtttttg tttttcattt gccatcccat       480
     tggacagaca tggagctata tcaacatttt caacactttg gctatgttgt aagcgcacga       540
     attcaacgag atgccaatgg aagaaataaa ggatatggtt ttgttagttt taataatcct       600
     gagtcagctt taaatgcaat aaaaggtatg catgggtttt acgtatcagg aaagcattta       660
     aaggttcagc taaaaaaagg ggaagagcat tatgtacaaa tgaatacacc agcacaacca       720
     caattaacac ctgcacaacc atactcagtt caacagccca tcataggaaa tcaccaccaa       780
     ccttatatga cacatttaat gtatggaggt atggactccc caaatcaaat gagatacaac       840
     acatattcta taagtagata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page