(data stored in ACNUC9543 zone)

EMBL: AL844507.PE231

AL844507.PE231       Location/Qualifiers
FT   CDS_pept        complement(1037100..1038608)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823500"
FT                   /product="inner membrane complex protein 1i, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0033:mRNA"
FT                   /db_xref="GOA:Q8IB69"
FT                   /db_xref="InterPro:IPR022086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB69"
FT                   /protein_id="CAD51138.1"
FT                   /translation="MQGETINVPSSSVPYTFEHSKHLKSKILKPIRQEKVVKVPVTQYV
FT                   EKIVEKEEIKYVNKYVDVIKPIITYKTKHISKPIYLDKIKYQPKVVEKEKIIHIPKIEY
FT                   RNKIVEIPVYVHKENIIEKKVPLIVERVVPVLKVNRVEKEILTNSFEIPEICEMTKDEN
FT                   NIHIGKNVHETNQQISCNVSEKGNSFVSEINKEKSDIYNIETYRHMQTTNASPKVYSQL
FT                   EISSSNMDNQNVETLKDKNNVVDSNDTSDEEEYNEGNLEHKNETRYHEATNEYSNYDFT
FT                   SEKNQKINDEENNSKELINNNNMEENYYDIDERFKDSNISHVSIHLPEEKGIEQQSYEQ
FT                   NYMNSCNNNYNIIESNLGDTSGSVYNNINTYGTYYSDNMNPQFDKTFVNQSYNGSKGYI
FT                   QKIMQRNHIPNYSTNTMEHLKIVEEKHPNSSNLHISNERFSTLPSVYGARSVTGKSNFV
FT                   PSYANSNGQAIVSVRPATIVEYVPKSKKYKASLCNFINKCCGNM"
     atgcaaggtg aaacaattaa tgtaccttct tccagtgttc cttacacctt tgaacattca        60
     aaacatttga agagtaaaat tcttaaacca atacgccaag aaaaagtagt gaaggttcct       120
     gttactcaat atgtagaaaa aatagtagaa aaagaggaaa ttaaatatgt aaataaatat       180
     gtagatgtta ttaaacctat tattacctat aaaacaaaac atatttcaaa acccatttac       240
     ttagataaaa ttaagtatca gccaaaagta gtagaaaagg aaaaaattat acatataccc       300
     aaaatagaat acagaaacaa aattgtagaa ataccagtat atgttcataa agaaaacatt       360
     atagaaaaaa aggtccctct aattgtagaa cgtgttgttc cagtattaaa agtaaacaga       420
     gttgagaaag aaattttgac taatagcttt gaaatacctg aaatatgtga aatgacaaag       480
     gatgaaaata atattcatat tggaaaaaat gtgcatgaga caaaccaaca aatttcttgt       540
     aatgtttccg aaaagggaaa ttcatttgta tccgaaataa ataaagaaaa aagtgatatt       600
     tataatatcg aaacatacag acatatgcaa acaaccaatg catcgcctaa agtttattca       660
     caattggaga tatcatcttc caatatggat aaccaaaatg ttgaaacatt aaaagataaa       720
     aataatgtag ttgatagtaa tgatacttct gatgaagagg aatacaatga aggaaacttg       780
     gaacataaaa atgaaacaag ataccatgaa gctactaatg aatattctaa ttatgatttt       840
     acatcagaga aaaatcaaaa gataaatgat gaagaaaaca attcgaagga attaattaat       900
     aataataata tggaagaaaa ttactatgat attgatgaac gctttaagga ttccaatata       960
     tctcatgtaa gtattcattt accagaagaa aaaggaattg aacaacagtc ctatgaacaa      1020
     aactatatga attcctgtaa taataattac aatataatag aatcgaattt aggagatact      1080
     agtggttcag tatataataa tattaacacc tatggtacat attattctga taatatgaac      1140
     ccacaatttg ataaaacctt tgttaaccaa tcatataatg gctctaaggg ttatattcaa      1200
     aaaataatgc agagaaatca tattcctaat tatagtacaa atacaatgga gcatcttaaa      1260
     atagtagaag aaaaacatcc aaattcatcg aatttacata tatctaatga aaggttttca      1320
     acattaccta gtgtatatgg cgcacgttcg gttacaggaa aatctaattt tgttccttcc      1380
     tatgctaata gtaatggaca agcaattgta tcagtacgac ctgcaacaat tgtagagtat      1440
     gtacctaaat caaaaaaata caaagcttca ttgtgcaatt ttattaataa atgctgtggt      1500
     aatatgtaa                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page