(data stored in ACNUC9543 zone)

EMBL: AL844507.PE239

AL844507.PE239       Location/Qualifiers
FT   CDS_pept        complement(1059246..1061567)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824300"
FT                   /product="GTP-binding protein Obg2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.33:mRNA"
FT                   /db_xref="GOA:Q8IB77"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB77"
FT                   /protein_id="CAD51130.1"
FT                   /translation="MHKKLKLIYKVALYAKRKSHVLYSSKRNITFATFKNELNHICDSI
FT                   LKPNVIHYNILQIRKKRLYLSFPYHSHSEKKNDILINDSAYEDNECIYVKGERGIYINK
FT                   KETINEKKKLETINKNFNEDNHMDINNDNTNCNSNSNSNSEYFENYIKEKKKNPSFEDI
FT                   YHKIITNNTQINVEHINSITYNSKDNNLYTEMFQGNIENDTSNSNESKLTLKCNKIKEK
FT                   NEALMKFLTEENDNIMIRNEKRFCDFLWVTTKSGKGGNPNYKKQRSKKLKGEGYGGHGG
FT                   NVILKSKKSIYDLIKIEQKVKANNGEDFKENSRGKDGKDKIIFVPVGTIVRKRISCKIK
FT                   NENNRKIYKSIFWYQFLNENEELLVARGGKGGISYSHFKKHDYRLPEKSETTLLELELR
FT                   LLNDVAFIGIENSGKTSLCSSLSKYLGNINSNTFTTTIPHVSNINYVDGVEITLLDTPY
FT                   LFFNAHKDKNKGKRILRHLYRSKLIVYVIDVSNDKLKNVDDLQIQEYYTQKETNEVTHN
FT                   ENIINKNINENMNISNSFCDINNSNIHNINYNVDNNLNNINNKHNDNSHILNINNNKKN
FT                   NIFITNIQNDHDENLKDYYNDTIKQIKMLRNELFLYNPEYLNKKELVVATKCDMLHKNS
FT                   LFNLDSLYYRLRNIFPHMEVIGTSAKFGLGIKLLSRKIRELIYPQHILQNKKLYSKHIE
FT                   DYVIPTYTHFTQGRMKLQNYELPEYLKHIYDYNYMENFDYFLKKKKKEKKTVDIKQYEE
FT                   LHINDNHKENSHYLIEDGKK"
     atgcataaaa agttaaagct catatataaa gtagcattat atgctaaaag aaagtcccat        60
     gtactttatt catcaaaaag aaatataaca tttgctactt ttaaaaatga gttaaatcac       120
     atatgtgata gtattttaaa accaaatgtt attcattata atattcttca aataaggaag       180
     aaaaggttat atttatcctt tccttatcat tcacatagcg aaaaaaaaaa tgacatactt       240
     attaacgata gtgcttatga agataacgag tgtatttatg ttaaagggga aaggggtata       300
     tatattaaca agaaagaaac cataaatgaa aagaaaaaat tagaaactat aaataaaaat       360
     tttaacgagg ataaccatat ggatattaat aatgataata ctaattgtaa tagtaatagt       420
     aatagtaata gtgaatattt tgaaaactat ataaaagaaa aaaagaaaaa tccttctttt       480
     gaagatatat atcataaaat aataacaaat aatacacaaa taaatgtcga acatattaat       540
     agtattacat ataatagtaa agataataat ttatatactg aaatgtttca agggaatatc       600
     gaaaatgaca catcaaatag taacgaatca aaattaacat taaagtgtaa caaaataaaa       660
     gaaaaaaatg aagcattaat gaaattttta acagaagaaa acgataatat tatgatacga       720
     aatgaaaaac gcttttgtga ttttttatgg gtaaccacaa aatctggaaa aggtggcaat       780
     ccaaattata aaaaacaaag aagcaaaaaa cttaaggggg aaggatatgg aggacatgga       840
     ggaaatgtta tattaaagag taagaaaagt atatacgatt taattaaaat agaacaaaag       900
     gttaaagcaa ataatggtga agattttaaa gaaaatagta gaggaaaaga tgggaaagac       960
     aaaattatat ttgttcctgt aggtactatt gtaagaaaaa gaatttcttg taaaataaaa      1020
     aatgaaaata atagaaaaat atataaaagt atattctggt atcaattttt aaatgaaaat      1080
     gaagaattat tagttgccag aggtggaaaa ggaggtattt cctattctca ttttaaaaaa      1140
     catgattata gattaccaga aaaaagtgaa acaactttac tagaattaga attaaggtta      1200
     ttaaatgatg tagcatttat aggtatagaa aatagtggga aaacctcctt atgtagtagc      1260
     ttaagtaaat atttaggaaa tataaatagt aatacattta ctactactat tccacatgta      1320
     tcaaatatta attatgtaga tggagttgaa ataaccttat tagatactcc ctatttattt      1380
     tttaatgcgc ataaagataa gaacaaagga aaacgaatat tacgacattt atacagaagc      1440
     aaattgattg tatatgttat tgatgtctcg aatgataaat taaaaaatgt agacgattta      1500
     caaatacaag aatattacac acaaaaggaa acaaatgaag taacacataa tgaaaatata      1560
     ataaataaaa atataaacga aaatatgaat atttcgaaca gtttttgtga cattaacaat      1620
     tctaacattc ataatataaa ctataatgtt gataataatt taaataacat taataataaa      1680
     cataatgaca attcacatat tctaaatatt aataataata aaaaaaataa tatatttata      1740
     actaatatac aaaatgatca tgacgaaaat ttaaaggatt attataatga tacgattaaa      1800
     caaattaaaa tgttacgcaa tgaattattt ttatacaatc cagaatattt aaataaaaaa      1860
     gaattagttg tagctactaa atgtgatatg ttacataaaa attctttatt caacttagat      1920
     tctttatatt atcgtttaag aaatatattc ccacatatgg aagttatagg aacgtctgca      1980
     aaatttggtt taggtatcaa attacttagt agaaaaatta gagaacttat ttatcctcaa      2040
     catatattac aaaataaaaa attatattcc aaacatattg aagattatgt tattcctacc      2100
     tatactcatt ttacacaggg aagaatgaaa ttacaaaatt atgagttgcc agaatatctc      2160
     aagcatatat atgactacaa ttatatggaa aattttgact atttcttgaa aaagaagaaa      2220
     aaagaaaaga aaaccgttga tataaaacag tacgaggaat tgcatataaa tgataatcat      2280
     aaggaaaact ctcattattt gattgaagat ggcaaaaaat ga                         2322
//

If you have problems or comments...

PBIL Back to PBIL home page