(data stored in ACNUC9543 zone)

EMBL: AL844507.PE242

AL844507.PE242       Location/Qualifiers
FT   CDS_pept        join(1068563..1069027,1069183..1069410,1069572..1069617,
FT                   1069724..1069770,1069888..1069902)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824600"
FT                   /product="Fe-S cluster assembly protein DRE2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.31:mRNA"
FT                   /db_xref="GOA:C0H4X5"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H4X5"
FT                   /protein_id="CAX64153.1"
FT                   /translation="MIINFVGNTLIIFNEDIPCDLLRKKYKELFVPTISVLDFKKKRLY
FT                   RKYNNIFLYTYKNYSFLWELENNILHKVQKCLNKNGILKLIIYLNKNDVITPDKHENKN
FT                   NNDIKVNIDQKDYCENYINDIFKNIKKECLYNGFINIVNETSVAENGIILNITAENPDF
FT                   LSNEDNDVSSDDEDLYNNEDDKKKVVNRVCDNCTCGKKEKLLNSENKVLINEKDGEYIT
FT                   ENVVSSCGNCYLGDAFRCASCPYKGLPAFQPGENVKLNLNNESN"
     atgataatta actttgtagg gaatacatta ataatattta atgaagatat tccgtgtgat        60
     ttgttaagaa agaagtataa ggagttattt gtaccaacta taagtgtatt agattttaaa       120
     aaaaaaagat tataccgaaa atacaacaac atctttttat atacttataa gaattactct       180
     tttttgtggg aattagaaaa taatattctt cataaggtac agaaatgttt aaataaaaat       240
     ggtatattaa aattaataat ttatttaaat aaaaatgacg ttataacacc ggataaacat       300
     gaaaataaaa ataataacga cataaaagtc aatatagatc aaaaagatta ttgtgaaaat       360
     tatataaatg acatttttaa aaatataaaa aaggaatgtt tatataacgg atttataaat       420
     atagttaatg aaacctcagt ggcggaaaat ggaattattt taaatattac ggctgaaaat       480
     ccggattttc tttctaatga agacaatgat gttagttcag atgatgaaga tttatataat       540
     aatgaagatg acaaaaaaaa ggttgtaaat agagtatgtg ataattgtac ttgtggaaaa       600
     aaagagaaac tactaaattc ggaaaataaa gttttaataa atgaaaaaga tggagaatac       660
     attacagaaa atgtagtatc ctcatgtgga aattgttatt tgggtgatgc attccgttgt       720
     gcctcttgtc cttataaagg tcttcctgct tttcaacctg gagagaatgt taagctcaat       780
     ttgaataatg aatctaattg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page