(data stored in SCRATCH zone)

EMBL: AL844507.PE244

AL844507.PE244       Location/Qualifiers
FT   CDS_pept        1075800..1079630
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824800"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0028:mRNA"
FT                   /db_xref="GOA:Q8IB82"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB82"
FT                   /protein_id="CAD51125.1"
FT                   /translation="MMNKFYYSFKNKENENDATDKIKENIFMKDNNNYDYNENSYDKNS
FT                   MYDDNKIIRKRSRKKKGEQDENMASKNIERKSSFNSFHLDNENVNKDYYYENYDMDDNK
FT                   YDKNGNVNYDNYNKNDDLLYNKNDDMLYNKNDDIYNNKNKNDSSNYNNGNSLINPEFIK
FT                   NIGICYNIINDETKFENDTCFKKISDIIELRITQIIEEANKFYEKRKRYTINKYLSIED
FT                   LTNCCNYLNVVIPYKYKNSFFYNFITLNENYKNNKIIYRLISKKEYPDYLKKRHSRKTY
FT                   EKRKKKLYHMQMKKEKIKNMQNKNVKEKNINKKHNKYNKHNKLNKYTKKNKHKFKHSSK
FT                   HMFKMIHNNFIGNEKKGTNNRTNLYNESYHTKKHKNKYTTHKNKINKHSKKNKKEHIKK
FT                   DTEVDQINNKESDITNHDKFNMFSENEKHDSPKEEQDELIKLDMNLSDNLDVNLSDNID
FT                   INLDNELDEYFDEFLEGQGQEEKYSEEKNQDLLDDDIFNFSDDDNKEESKEKYFDNKNK
FT                   SSEYNNNNNNNNNNNNEDNNEDNNENNIDNDNDNNNNIDLDLSSLDFNNNDKNSIIIEN
FT                   DQLNDEDIFSEDLMNNNIKREENIIKSDEYNKLDMSNLKGNENMNEKNFITPYHENNND
FT                   NLSDTLQDERSIKSDINMNIDNNILYNSYIKNNENKKKNVLKMLLCGMENNLPAETNIT
FT                   IFWLFVQNGYREKRKKKKKKNDKEKDKDQNNNYNDPGDEIHFNFDENEKREDKNVAAYF
FT                   NYQCHEILYTIEKKKRYKNYIGKQNVLNEHENFKYNNIFLLPKFYPINKEYAILSKYIL
FT                   EIIKDIINYRINFFDYNNILHIFSTSKQINKILTNILFFLFNELDHNLRLNNIYASLML
FT                   LILLNGIIKNNNIDIDFYCLQILKMLIHVIIYEHELRLKNIYIILLLKRKACDIIIDFC
FT                   SVLKKQNNNEIINIDYYLIYILSKLLTHNKCTYMHIYVSYYLIYLMPINIHIKFFLSYT
FT                   PNFLTIFFKKYIYYQNVYSSFSSYDQKELNELFNFFFFHIYTLIQGSIYRIFKNINLLI
FT                   INSASCNYLNYLFNFIINYADYHLPLILCILNVIDKNYSPHKNDPIYHLQQKRKNSKKR
FT                   RLKKIKKIMMKRMKININKRRTKKKKKLKRNKKNNNKYLIKSKNYLKSVKDITKFYLNK
FT                   KPNSDNGDDSYYEDDYLNPESFNSNIFGYNNYSKKQYFNSYIKKRISLNKPLIQHSKEK
FT                   NELRTNIAVNNVLNKILNKFEKRRKKKKHKTKNHQYDAYLYDTCYYFLYTF"
     atgatgaata aattttatta ttcttttaag aataaggaaa atgaaaatga cgcaacagat        60
     aaaattaaag aaaacatttt tatgaaagat aataataatt atgattataa tgagaacagt       120
     tatgataaga atagtatgta tgatgataat aaaataataa gaaaaagaag caggaagaaa       180
     aaaggcgaac aggatgaaaa tatggcttca aaaaatattg aaagaaaaag ttcttttaat       240
     agctttcatt tggataatga aaatgtaaat aaggattatt attatgaaaa ttatgatatg       300
     gatgataata aatatgataa aaatggaaac gtaaattatg ataattataa taaaaatgat       360
     gacttgctat ataataaaaa cgatgacatg ctatataata aaaatgatga catatataat       420
     aataaaaata aaaatgatag tagtaattat aacaatggta atagtctaat taatccagaa       480
     tttataaaaa atattggtat atgttataat ataataaatg atgaaacgaa atttgaaaat       540
     gatacatgtt ttaaaaaaat ttcggatata attgaattaa gaattaccca aataattgaa       600
     gaagctaata aattttatga gaaaagaaaa agatatacca taaataaata tctaagtata       660
     gaagacctaa caaattgttg taattatttg aatgttgtaa taccatataa atataaaaat       720
     agtttctttt ataattttat tacattaaat gaaaattata aaaataataa aattatatat       780
     agattaattt ctaagaagga atacccagat tatttaaaaa aaaggcattc cagaaagaca       840
     tatgaaaaaa ggaaaaaaaa attatatcat atgcaaatga aaaaggaaaa aattaagaat       900
     atgcaaaata aaaatgtcaa agaaaaaaat attaacaaaa agcataataa atataataaa       960
     cataataaac ttaataaata tacaaagaaa aataaacaca agtttaaaca tagtagtaaa      1020
     cacatgttca aaatgattca taacaatttt ataggaaatg aaaagaaagg aacaaataat      1080
     agaactaatt tatataatga atcataccat acaaaaaaac ataagaacaa atatacaaca      1140
     cataaaaata aaataaataa acattccaag aaaaataaaa aggaacacat taaaaaggat      1200
     accgaagttg atcaaataaa taataaagaa agtgatatta caaaccatga taaatttaat      1260
     atgtttagtg aaaatgaaaa acatgattca ccaaaagagg aacaagatga attaataaaa      1320
     ttggatatga acttgtcaga caatttggat gtaaatttat cagataatat agatataaat      1380
     ttagataatg aactggatga atactttgat gaatttctag aaggtcaagg acaagaagaa      1440
     aaatatagtg aagaaaaaaa tcaagaccta ttagatgatg atatattcaa tttttctgat      1500
     gatgataata aggaggaaag taaagaaaaa tattttgaca acaaaaataa gtcttctgaa      1560
     tataataata ataataataa taataataat aataataatg aagataataa tgaagataat      1620
     aatgaaaata acattgataa tgataatgat aataataata atatagatct tgatcttagt      1680
     agtttagatt ttaataataa cgataagaat tctataataa ttgagaatga tcaattaaat      1740
     gatgaagata tttttagtga ggacttaatg aataataaca taaagagaga ggagaatata      1800
     ataaaatcgg atgaatataa taaattagat atgtctaatt taaaaggtaa tgaaaatatg      1860
     aatgagaaga attttataac tccttatcat gaaaataata atgataacct ttcagatacg      1920
     ttacaagatg aaaggtctat aaaatctgat ataaatatga atatagataa taatatatta      1980
     tataattcat atataaaaaa taatgaaaat aaaaaaaaaa atgttctgaa aatgttatta      2040
     tgtggtatgg aaaataactt acctgctgaa accaatataa ccatattttg gttattcgta      2100
     caaaatggtt atagagaaaa aagaaagaag aaaaaaaaaa aaaacgacaa agaaaaagat      2160
     aaagatcaaa ataataatta taatgaccca ggtgatgaaa tacattttaa tttcgatgag      2220
     aatgaaaaaa gagaagataa aaatgtagct gcttatttta attatcaatg tcatgaaatt      2280
     ttatatacta ttgagaaaaa gaaaaggtat aaaaattata taggaaaaca aaatgtacta      2340
     aatgaacatg aaaattttaa atataataat atatttttat taccaaaatt ttatcctata      2400
     aataaagaat atgcaatatt atctaaatat attttggaaa taataaaaga tattattaat      2460
     tatcgtatta acttttttga ttataataat attttacata ttttcagtac atcgaaacaa      2520
     ataaataaaa tattaacgaa tattttattt tttcttttta atgaattaga tcataattta      2580
     agattaaata atatctatgc atctttgatg ttattaatat tattaaatgg tataataaaa      2640
     aataataata ttgatatcga tttctattgt ttgcagatat taaaaatgtt aattcatgtt      2700
     attatatatg aacatgaatt acgattaaaa aatatatata ttattttatt attaaaaaga      2760
     aaagcttgtg atattattat agatttttgt tcagtgttga agaaacaaaa taataatgaa      2820
     attataaata ttgattatta tttaatatat atattaagca aattattaac acataataaa      2880
     tgtacatata tgcatatata tgtatcttat tatttaatat atttaatgcc aattaatatt      2940
     cacataaaat tctttttatc atatacacct aatttcttaa ccatattttt taaaaaatat      3000
     atatattatc aaaatgtgta tagttctttt tcatcttatg atcaaaaaga attaaacgag      3060
     ttatttaatt ttttcttctt tcatatatat acactaatac aaggatctat atatcgcata      3120
     tttaaaaata ttaatttgtt aataattaat tcagcatcat gtaactattt aaattatttg      3180
     tttaatttta ttattaatta tgccgattat catttaccat taattttatg tatcttgaat      3240
     gttatagata aaaattattc tccacataaa aacgatccaa tttatcatct tcaacaaaaa      3300
     agaaaaaata gtaagaagcg aagattgaag aaaattaaga aaataatgat gaaaaggatg      3360
     aaaataaata taaacaaaag gagaaccaaa aagaaaaaaa aacttaaaag aaataaaaaa      3420
     aacaataata aatatttaat taaaagcaaa aattatttaa agagtgttaa ggatatcaca      3480
     aaattttatt taaataaaaa acctaatagt gataatggag atgatagtta ttatgaagat      3540
     gactatttga atcctgagtc ttttaattca aatatttttg gttataataa ttatagcaaa      3600
     aaacaatatt ttaattctta cattaagaaa agaatatctc taaacaaacc gttaattcaa      3660
     catagtaagg aaaaaaatga gttacgcaca aacattgctg ttaataatgt tttaaacaaa      3720
     atattaaata agtttgaaaa acgaagaaaa aaaaaaaaac ataaaacaaa aaatcatcaa      3780
     tatgatgcat atttatatga cacatgttat tactttttat atacattcta a               3831
//

If you have problems or comments...

PBIL Back to PBIL home page