(data stored in SCRATCH zone)

EMBL: AL844507.PE245

AL844507.PE245       Location/Qualifiers
FT   CDS_pept        complement(1080055..1082991)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0027:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB83"
FT                   /protein_id="CAD51124.1"
FT                   /translation="MHMKLIDEVLTKWRRKEINLFKVCLYFHCIKKSLKLLEDKNDFFI
FT                   NLINDSIFEEIINLSKQKITDNNNNSNNNNNNNNSFNDEDKFFFVIFVTFIFNLENEYI
FT                   NDQNKGLLHLINNDNNKEYEKNIQHNKDKLKQNNKNIRDNSSQNLFNQNKYKKIDILIK
FT                   NIIDLEISQHISSPPKENKFINYKIYAYYAIIQFIFHILQNNDEQAGKIFSKYIKNIFT
FT                   TLLNINHTILCNENILSLANKTLLFIVFINHHLIKDNEKEFFNFLFIQLNKYNEYMLPI
FT                   IQEIFVTYLKKKKKLMLNKEIYQYLDNYLNDNISLLLKYGKKENLFFFLNVLSIYKIFI
FT                   KKYISNNDQNVYTIKNEDNVHIILNIKHIINNVNKLLEYLVHISKDYIYNNTNIDISLY
FT                   NQDSIYYNKPEENTNDKRTSYFVDNIIKEVDKEKYAINSVQSINHEFNTTLVQNYSLYQ
FT                   NNNLFSYITYHICTFFNDISNIIDTECISINTTYFIHFMKPFLSSHNNEDDLFLTYFLI
FT                   KHLYTYTENLLKKCPIIFDGFVNYIMYLFKHINLLTKNNFSITEQTNLINILNKIKNVE
FT                   HVNDIVDIYCTLYIHLVQNLSLFLKYLKYYNNEEIKEKILVHYEYFIFHVFHETNNVNF
FT                   HIIFKNNNAAFVTLKLLYNLLKINNFHFENIHNIYFKLCKVQNHLQNIHEQNSQHYLYT
FT                   YQNHMANTNSIFYLNKIKTFLLNNLDSISNDKKTPFYIANKKKKLKYKSPRQIKNIHHN
FT                   NNESGLVLSAQESVNSASQIINKQKKKKKKKDKKKKKKKKKNPLAEIKNPINDVKRSKQ
FT                   EINESNESLDERIDEEIERNSQNSIMDNNIISYNVNEIEQSQNLGKNEEYTEMEQEQNE
FT                   LNNDMMVTYNVTNNNEHMNKENDKLCNNENEYNEFNSISVKNKCDETLKKKMEKKKSLK
FT                   NKNLDHNNNVAHKNSLEIKTLKENIKMVSSSDAINSLKFMKQSILNDL"
     atgcatatga aattgatcga tgaagtatta acaaaatgga gaaggaaaga aataaattta        60
     tttaaagttt gtttatattt tcattgtata aaaaaaagtt taaaattact ggaagataaa       120
     aatgatttct tcataaatct tattaacgat tcaatctttg aagaaataat aaatttaagt       180
     aaacaaaaaa taacagacaa taacaataac agtaacaata ataataataa taataattct       240
     tttaatgatg aagataaatt tttctttgtc atctttgtaa ctttcatttt taatttagaa       300
     aacgaatata taaatgatca aaataaagga cttctgcact taataaataa tgataataat       360
     aaagaatatg agaaaaatat acaacataat aaggataaac taaaacaaaa taataaaaat       420
     ataagagata attcttcaca aaatttattt aatcaaaata aatataaaaa aatagatata       480
     cttatcaaaa atattataga tttagaaata tcacaacata tatcatcacc ccctaaggaa       540
     aataaattta ttaattataa aatatatgcc tattatgcta ttatacaatt tatttttcat       600
     atattacaaa ataatgatga acaggcagga aaaatatttt ccaaatatat taagaatata       660
     tttacaacgc ttttaaatat taaccatacc attttatgca atgaaaatat tctatcatta       720
     gcaaataaaa cattactttt cattgtattt attaatcacc atttaataaa agataatgaa       780
     aaggaatttt ttaattttct atttatacaa ttaaacaaat ataatgaata tatgttacct       840
     atcatccaag aaatttttgt aacctattta aaaaaaaaaa agaaacttat gttaaataaa       900
     gaaatatatc aatatttaga taattattta aatgataata taagtttatt attaaaatat       960
     gggaaaaaag aaaatttatt ttttttctta aatgtcttaa gtatttataa aatatttatt      1020
     aaaaaataca ttagtaataa tgatcaaaat gtgtatacca taaaaaatga agacaatgta      1080
     catattatat taaatataaa acatattatt aacaatgtta ataaattatt agaatattta      1140
     gttcatatat caaaagatta tatatataat aatacaaata tagatatttc cttatacaat      1200
     caggattcta tatattacaa caaacctgaa gaaaacacaa atgataaaag aacatcctat      1260
     tttgtagaca atattataaa agaagtagat aaagaaaaat atgctataaa tagtgtacaa      1320
     agcataaatc atgaatttaa cacaacgtta gtacagaatt atagtcttta tcaaaataac      1380
     aaccttttta gttatataac atatcatata tgtacatttt ttaacgatat atcaaatatt      1440
     atagatactg aatgtataag tatcaataca acgtatttta tacattttat gaaacctttt      1500
     ctttcatctc ataataatga agatgattta tttttaacgt atttcttaat taagcatctt      1560
     tatacataca cagaaaattt attaaaaaaa tgtccaatca tatttgatgg gtttgtgaat      1620
     tatattatgt acttattcaa acatataaac ctgttaacaa aaaataactt ttcaataaca      1680
     gaacaaacga acttaattaa tatattgaat aagataaaaa atgtggaaca tgtaaatgat      1740
     attgttgata tttattgtac tttatatatt catttggtgc aaaacctttc tctatttctt      1800
     aaatatttaa aatattataa caatgaagaa attaaagaaa aaattttagt tcattatgaa      1860
     tatttcattt tccatgtatt ccatgaaaca aataatgtta atttccatat tatttttaaa      1920
     aataataacg ccgcttttgt tacattaaag ttattatata atcttttaaa aataaataat      1980
     ttccattttg aaaatataca taatatatat tttaaattgt gcaaagtaca gaaccattta      2040
     caaaatatac acgaacaaaa ttctcaacat tatttatata catatcaaaa ccatatggct      2100
     aatacgaata gtatatttta tttaaacaaa ataaaaacat tcttattaaa taatttggac      2160
     tctatatcca atgataagaa aacaccattt tatattgcaa acaaaaaaaa aaaattaaaa      2220
     tataaatcac ctagacaaat taaaaacatt catcataata ataatgaaag tggattagta      2280
     ttgtccgcgc aagaaagtgt taattcagct agccaaatta taaacaagca aaagaaaaaa      2340
     aaaaaaaaaa aagataaaaa aaaaaaaaaa aaaaaaaaaa aaaatccgct agctgaaatt      2400
     aaaaatccta ttaatgacgt gaaaagaagt aaacaggaaa taaatgaaag taatgaatca      2460
     ttggatgaaa gaatagatga agaaatagaa agaaattcac aaaatagtat aatggataat      2520
     aatattatct catataatgt aaatgaaatt gaacaaagtc aaaatttagg aaaaaatgaa      2580
     gaatatactg aaatggaaca agagcaaaat gaattaaata atgatatgat ggtaacatat      2640
     aatgttacta acaataatga gcatatgaat aaggaaaacg ataaattatg taacaatgaa      2700
     aatgaatata atgaattcaa ttcaatatct gtcaagaaca aatgtgatga aaccttaaaa      2760
     aaaaagatgg aaaagaaaaa atcattaaaa aacaaaaatt tagatcataa taacaatgtt      2820
     gcacataaaa attcattgga aataaaaaca ttaaaagaaa atataaaaat ggtatcatcc      2880
     tcagatgcta taaattcttt aaagtttatg aaacaatcaa ttttaaatga tttataa         2937
//

If you have problems or comments...

PBIL Back to PBIL home page