(data stored in ACNUC9543 zone)

EMBL: AL844507.PE246

AL844507.PE246       Location/Qualifiers
FT   CDS_pept        join(1086048..1090972,1091179..1091248)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.29:mRNA"
FT                   /db_xref="GOA:C0H4X7"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X7"
FT                   /protein_id="CAX64155.1"
FT                   /translation="MTSNYKSYNVLDYNLRFIQDEKRNRERERADNKNKENISLSINSD
FT                   MGNKIYLLETNAKSRKVEKDEKYKNISSSNYMKDKTYVDKNLGVKDDMSNLSSIKYNIE
FT                   INRNRNNNRNNNRNNNSNSNSFIMDEKEKTNNRTIMLLKHKRKYDPDYNTSDEKNIKRK
FT                   KINDIINKYKKKMIIPSYEENDEKYSNKGSFNISDDDEMDNKSSNYNISGKNYSTENND
FT                   NKNNFHIRSLEKMDKINNEMKEYSTKDSIDLRRVESISHGSKENNNIDKLKCHNLIRNK
FT                   NSNLVNFDRNKRKENFIFLHNYMKKKENGNKTNINSYDIENIHDEKKDKNEILNNLDIN
FT                   SYNEEKCLSYNNMKENDFNKIGISKQPNVDSKERKYNKYEKDHNIYNDLSDDGKSIDRT
FT                   NVYDNNSSSHNVSLSNLFNESNFMLDEKKIRDKFKEVKLIEKSLERNNSEIYENELKEG
FT                   ETHKKDELNKLVLDMTIKDINEKKKKVILYHKDYSENYERKSISSENIDIGPTNRSFLV
FT                   DGNNTKDMTHINENNDRDKNNDNINNDNIIINNDNNINNNNVYNVKESNEDIFYKANKL
FT                   SEKIDNIVQNIRNIKKIKKSNSGNYNIDANLSDGISNDEANLKNVTNSMDYTKLYYDDD
FT                   KGENTKNTFKKSAYDKNKKLLIENDTKLMIHGNNNQKEWIRNDEKYLLNGINNSPKDLD
FT                   NKRSNIDIQVNNNNNNNNDTTFYDAMEYSIGNDKEQYNKNVQEDHVIMGVESNKNNMQT
FT                   NCSSSNNKNYINNDRWNHLKEKYFDMMKPGVVDNIINIKENELVLQKNEKKKDIFNKSH
FT                   GNEKIEPLKDFNNKNVKVTNILKNKVNDDIHEDVKSVNIGNEIDENRKIKKKENILNSI
FT                   NQEKDIGNKNIINKTSYSKKNLLSKSYAEKPHLYNMKEKKKNNINVNKCKEKNPLFYSV
FT                   DFSNQKKNDIDKRMCDDLLSPGIDDSIERKIIYENIIKFSKRNVNNEHELVDTYSDGKK
FT                   KKEKSNERLKEELDMIKNYYSEEKLKREEEYKLRNEIQQKRKLYELKIRKDFEEKIRLR
FT                   REENEKRLNEEKINKIQQDNGKKELPNGIPDGKPNDMSSEENEKKHITYNNEKKNYDNI
FT                   EKNYDNIEKKNYDNNDGNNNNYYYDELRNETYKNNKKKKRKNLFEDYSSDGSYYKYMYR
FT                   NLYEETCNNKMKNHFYDISDNLYLQECSDNFFHNNKISSSSIYKSPSHSFDNELISLSK
FT                   IKFDDFDYNYLNELHKSVSKTKERKRSNYSDFSEDQKKLKNCNLVKPRVILTNSEKSYE
FT                   QKCGEHSKRGEEMNGEYEKGDIYKKNDIYKNSDMCEDNNVHQKNDIYEDNNIHQKNDIN
FT                   ERDDSHKKGDIYERNGFHEKNAVLKRNILNKNNNTGNLHNKNVGNSQKGKNRSLDYHRR
FT                   SNIQNFYEYKMNNNVDDNILNKLLTIKYENKIRNDSLSIKEDNIHNTKEGSVHEEMCEE
FT                   EEDFEEKYSEDIDIEDENISVKLNHNDSEYNKNNCKGVKLIQNKSDFNNENMDELNVSP
FT                   THTEIDKEEKQNVLLISTKEKSRIIKVNEKVDISPIKQIIQEEKNEPNDNINMDINDDE
FT                   DNEGKSKLKTSISSSENGIPKINILKNNENYIPLDIALNFVMDNEKLKKNLQKEEKKDK
FT                   GKKKTFVQWLMDERKRRLKNNLPIDI"
     atgacatcaa attataaatc ttacaatgtt cttgattata atttaaggtt tatccaagat        60
     gaaaaaagga atagggaaag agaaagagca gataataaga acaaggaaaa catatccttg       120
     agtataaatt cagatatggg aaacaaaata tatttattag aaacaaatgc aaaaagtcga       180
     aaagttgaaa aggatgagaa atataagaat ataagttcat caaattatat gaaagataaa       240
     acttatgttg ataaaaattt gggtgtaaaa gatgatatgt caaatttaag ctccataaaa       300
     tataatatag aaataaatag aaatagaaat aataatagaa ataataatag aaataataat       360
     agtaatagta atagttttat tatggatgaa aaggaaaaaa ctaataatag aacgattatg       420
     ttattaaagc ataagagaaa atatgaccca gattataata cctcagatga aaagaatata       480
     aagagaaaaa aaataaatga tattattaat aaatataaaa aaaaaatgat aattccttca       540
     tatgaagaaa atgatgaaaa atatagtaat aaaggatcat ttaatatttc agatgatgat       600
     gagatggata ataaaagtag taattataat ataagtggta aaaattattc tacagaaaat       660
     aatgataaca aaaataattt tcacataaga tctttagaaa aaatggataa gataaataat       720
     gagatgaaag aatactcaac taaagattcc attgatctta gaagggtaga atccatatca       780
     catggatcaa aagaaaataa taatattgat aagttaaaat gtcataattt aataagaaat       840
     aaaaattcca acctcgtaaa ttttgatagg aataaaagaa aagaaaattt cattttctta       900
     cacaattata tgaaaaaaaa ggagaatgga aataagacaa atattaattc atatgatata       960
     gaaaatatac atgatgaaaa aaaagataaa aatgaaatac ttaataattt agatataaat      1020
     tcttataatg aagaaaaatg tttaagttat aataatatga aggaaaatga cttcaataaa      1080
     attggcatat ctaaacaacc aaatgtagat tctaaggagc gtaagtataa taaatatgaa      1140
     aaagatcata atatatataa tgatcttagt gatgatggaa aatctataga tcgtactaat      1200
     gtatatgata ataattcaag ttctcataat gtaagtttaa gtaatttatt taatgaaagc      1260
     aatttcatgt tagacgaaaa aaaaattaga gataaattta aagaagtcaa attaattgaa      1320
     aaatcacttg aaagaaataa ttcggaaata tatgaaaatg aattaaaaga aggggagact      1380
     cataaaaagg atgaattaaa taaattggta ttggatatga caataaaaga tattaatgaa      1440
     aaaaaaaaaa aagtaatatt atatcataaa gactattcag agaattatga aagaaaatct      1500
     ataagcagtg aaaatattga tataggacca acgaatagat catttttagt tgatggaaat      1560
     aatacaaagg atatgactca tataaatgaa aataatgata gggataaaaa taatgacaat      1620
     attaataatg ataatattat tattaataat gataataata taaataataa taatgtttat      1680
     aatgtaaaag aatcaaatga agatatattt tataaggcta ataaattatc tgaaaaaata      1740
     gacaacattg tacaaaatat tagaaatatc aagaaaataa aaaagtcaaa ttctggaaat      1800
     tataatattg atgccaacct ttcagatggt atatcgaatg atgaggcaaa cctgaaaaat      1860
     gttacaaatt ctatggatta tacgaaatta tattatgatg atgataaagg agagaataca      1920
     aaaaatactt ttaagaaaag tgcatatgat aaaaataaaa aattattgat cgaaaatgat      1980
     acaaaattaa tgatacatgg aaataataat caaaaggaat ggataagaaa tgatgagaaa      2040
     tatcttttga atggtataaa taatagtcca aaagatttag ataataaaag atcaaacatt      2100
     gacatacaag ttaataataa taataataat aataatgata caacatttta tgatgctatg      2160
     gaatattcta taggtaatga taaagaacaa tacaataaaa atgtacaaga agatcatgta      2220
     attatgggag ttgaatcaaa taaaaataat atgcaaacga attgctcttc atctaataat      2280
     aaaaattata taaataatga tagatggaat catttgaaag aaaaatattt cgacatgatg      2340
     aaaccaggtg ttgtagataa tattataaat attaaagaaa atgaacttgt attacagaaa      2400
     aatgaaaaaa aaaaagatat ttttaataaa tcacatggaa acgaaaagat agaaccatta      2460
     aaagatttta ataataaaaa tgttaaggtt acaaatattt taaaaaataa agtaaatgat      2520
     gatatccatg aagatgttaa aagtgttaat attggaaatg aaatagatga aaataggaaa      2580
     ataaaaaaaa aggaaaatat attaaatagt ataaatcaag aaaaagatat tggaaataaa      2640
     aatattatta ataaaacgtc atattcaaaa aaaaaccttt tatcaaaaag ttatgcagaa      2700
     aaacctcatc tatataatat gaaagaaaaa aagaaaaata atattaatgt gaacaaatgt      2760
     aaggaaaaaa atcctttatt ctattctgtt gatttctcaa accaaaaaaa aaatgatata      2820
     gataagcgaa tgtgtgatga tttattatct ccaggtattg atgattcgat tgaaagaaaa      2880
     ataatatatg aaaatataat aaaattttcc aaaagaaatg taaataatga acatgaatta      2940
     gtagatacat attcagatgg aaaaaaaaaa aaagaaaaat ccaatgaacg actaaaagaa      3000
     gaattggata tgattaaaaa ttattatagt gaagagaaat taaaaaggga ggaggaatat      3060
     aaactgagaa atgaaattca acaaaaaaga aaattgtatg aattaaaaat tcgaaaagat      3120
     tttgaggaaa aaataaggct tcgaagggag gaaaatgaaa aaaggctaaa cgaagaaaaa      3180
     ataaataaaa tacaacaaga taatggaaaa aaggaattac caaatggtat accagatggt      3240
     aaaccgaatg atatgtcaag tgaagaaaat gagaagaagc atattactta taataatgaa      3300
     aaaaaaaatt atgataatat tgaaaaaaat tatgataata ttgaaaaaaa aaattatgat      3360
     aataatgatg gtaataataa taattattat tatgatgaat taagaaacga aacttataag      3420
     aacaataaaa aaaagaaaag aaaaaaccta tttgaagatt attcaagtga tggaagttat      3480
     tataaatata tgtatcgtaa tttatatgaa gaaacgtgta acaataaaat gaaaaatcat      3540
     ttttacgata taagtgataa tttatattta caggaatgtt ctgataactt ttttcataat      3600
     aataaaatct cctcatcttc tatttataaa tcaccttcac atagttttga taacgaatta      3660
     atatcattaa gtaaaataaa atttgatgat tttgattaca attatttaaa tgaactccac      3720
     aaatcggtat ctaagacaaa agagagaaaa agaagtaatt attctgattt tagtgaagat      3780
     cagaaaaagt taaaaaattg caacctagtt aaacctaggg ttattttaac aaatagtgaa      3840
     aagagttatg aacaaaaatg tggtgaacac tccaaaaggg gcgaagaaat gaatggggaa      3900
     tatgaaaaag gtgatatata taaaaagaat gatatatata aaaatagtga tatgtgtgaa      3960
     gacaataatg tacaccaaaa gaatgatata tacgaagata ataatataca tcaaaagaat      4020
     gatataaacg aaagagatga ttctcataaa aaaggagata tatatgaaag gaatggcttt      4080
     catgaaaaaa atgcagtatt aaaaagaaat attctaaata agaacaacaa tacaggaaat      4140
     cttcataata agaatgtcgg caattcacaa aaaggaaaaa accgatcgct tgattatcat      4200
     cgtagaagta acatacaaaa tttttatgaa tataagatga ataataacgt tgatgataat      4260
     atattgaata aattgttaac tataaaatat gaaaataaaa taagaaatga tagtttaagc      4320
     ataaaagagg ataacattca caatactaag gagggtagtg tacatgaaga gatgtgtgaa      4380
     gaggaagaag attttgaaga gaaatattca gaagatattg atattgagga tgaaaacatt      4440
     tctgttaaac taaatcacaa cgatagtgaa tataataaaa ataattgtaa aggtgtaaaa      4500
     ttaatacaaa acaaaagtga ttttaataat gaaaatatgg atgaattgaa tgtatcacca      4560
     actcataccg aaattgataa agaagaaaaa cagaatgtat tgttaatttc tacaaaagaa      4620
     aaaagtagaa ttataaaagt aaatgaaaag gttgatatat ctccaataaa acaaataata      4680
     caagaagaaa aaaatgaacc aaatgataat ataaacatgg atattaatga tgatgaagat      4740
     aatgagggaa aaagtaaatt gaaaacatcc atatcatctt cagagaatgg aataccaaaa      4800
     attaatattt taaaaaataa tgaaaactat ataccattag atattgcttt aaattttgtg      4860
     atggataacg aaaagttgaa gaaaaattta caaaaggaag aaaaaaaaga taaaggaaag      4920
     aagaaaacct ttgttcagtg gttaatggat gaaagaaaaa gaagattaaa aaataactta      4980
     cccatagata tttaa                                                       4995
//

If you have problems or comments...

PBIL Back to PBIL home page