(data stored in ACNUC9543 zone)

EMBL: AL844507.PE247

AL844507.PE247       Location/Qualifiers
FT   CDS_pept        join(1091998..1092058,1092147..1092205,1092376..1092471,
FT                   1092604..1092711,1092852..1092950,1093084..1093221)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825100"
FT                   /product="ankyrin-repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.28:mRNA"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB85"
FT                   /protein_id="CAD51122.1"
FT                   /translation="MISLTLISDRVRDKLSDLALWNIKRTKKLLKKNDINSKFLNNNNL
FT                   LQICSYNDDVEMFCFLLNRGCDFKHINDNGDTCLHIIVLNNNIYCLDILCRNNIKDIIN
FT                   IKNKDGDTALHISIKNGFYESFSLLLKYGVDILIKDDFDMDAYELLDVFRKKEKFYDSN
FT                   CNKYSIMFNLLIKEKMKGEIRKI"
     atgatatctt taactttaat aagtgaccgt gttcgtgata aattatctga tttagcactg        60
     tggaacatca aaagaaccaa aaagttgttg aaaaaaaatg atatcaattc gaaatttttg       120
     aataacaata atttactaca aatatgttcc tataacgatg atgttgaaat gttttgtttt       180
     ttattaaaca ggggatgtga cttcaaacat ataaacgata atggagatac atgtttacat       240
     atcattgtgt tgaataacaa catttattgt ttagatatac tttgcagaaa taatattaaa       300
     gatattatta atataaaaaa caaagatggt gatactgctt tacatatatc tattaaaaat       360
     ggtttttatg aatcattttc tttattatta aaatatggtg ttgatattct tatcaaagat       420
     gatttcgata tggatgctta tgaattgtta gatgtgttcc gaaaaaagga aaagttttat       480
     gatagtaatt gtaataaata ttcgattatg ttcaatttat taataaaaga gaaaatgaag       540
     ggtgaaataa ggaaaatata a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page