(data stored in ACNUC9543 zone)

EMBL: AL844507.PE249

AL844507.PE249       Location/Qualifiers
FT   CDS_pept        complement(1095116..1095562)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825300"
FT                   /product="SAYSvFN domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.26:mRNA"
FT                   /db_xref="GOA:Q8IB87"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR019387"
FT                   /db_xref="InterPro:IPR039159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB87"
FT                   /protein_id="CAD51120.1"
FT                   /translation="MSKKKKNSKNKNINKYFNPKIVTAILLCSCYFLYNTFGSVYIIIV
FT                   LIAIIFLNLDNNNDSSISAYSIFNKGKRYLIGDLRMNQIENELRNTKYKNNDSEDNFLR
FT                   YDDIDKNKFYIKGSSKYNNKLCTCGSKKKFKKCCGIIKNSSSDF"
     atgtctaaga aaaaaaagaa cagtaaaaat aaaaatatta acaaatactt caaccctaaa        60
     atcgttactg ctatattgtt gtgttcatgt tattttctat ataacacgtt tggtagtgta       120
     tatatcataa tagttttgat agccatcatt tttttaaatt tagataataa taatgacagc       180
     tctataagcg cctattccat atttaataag gggaaaagat atttaatagg agatttgagg       240
     atgaatcaaa ttgaaaatga attaagaaat acaaaatata aaaataatga cagtgaagat       300
     aattttttaa gatacgatga tattgataaa aataaatttt atattaaagg atcatcaaaa       360
     tataataata aactatgtac ttgtgggtct aaaaaaaagt ttaaaaaatg ttgtggtatc       420
     attaaaaata gttcatctga tttttaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page