(data stored in ACNUC9543 zone)

EMBL: AL844507.PE254

AL844507.PE254       Location/Qualifiers
FT   CDS_pept        1103768..1105108
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825800"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.25:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X9"
FT                   /protein_id="CAX64157.2"
FT                   /translation="MKGRQSLSFLLLSVPYFFLFLWNEDIKCQSLLPVSYASHQMYSFD
FT                   KLTPHEIKSDLKKTFGNFISSKIQVLKNKFKLYDIKNREKYNNEEGNDSDLIGDAYISS
FT                   LEDEIKHLLEQAENKRMLSKKIKSSYERAHKNLKKRRNVEDDGKMKNVLKQNLQHIDYL
FT                   NKKSDYLEKKAGELKNILERRGNENAKEGNDNDEKNIYNNEYHNNCSISKRGTLKFINS
FT                   SNGLKHSIDNVNGMINENGFTIFYKNKKKMTYFWSVLELPIKMIGSIEQCFYFIYKNNN
FT                   QIFCADNKIKAYSWMNSLSEASLCFHFGIKGVLINSNINNINKNDDMNNTNDENVKHSD
FT                   FMNNISNGIKQGKKNKQKKIDENSLTVDIKPEDTGTRIFVNDVEQKINKDVPGKDNVFN
FT                   LNDIKKKMDDERKTPQSENDEDQQGGYDKMEENEKEDTQMDNDDYEM"
     atgaaaggga gacaatcctt gtcgttcttg ttgttgtcgg tcccatattt tttcctgttt        60
     ctttggaatg aggatataaa gtgtcaaagt ttattgcccg tatcttatgc ttctcatcaa       120
     atgtattctt ttgataaatt gacacctcat gaaataaaga gcgacttgaa aaaaacgttt       180
     ggtaatttta ttagtagtaa gatccaagta ttaaaaaata aattcaaatt atatgatata       240
     aaaaatagag agaaatataa taatgaagaa ggtaatgata gtgatttaat aggagatgca       300
     tatatatctt ctttagaaga tgagataaaa catttactgg aacaagcgga aaataaaagg       360
     atgttatcta aaaaaataaa atcatcttat gagagggcac ataaaaattt aaaaaaaaga       420
     agaaatgtgg aagatgatgg aaagatgaaa aatgttttaa aacaaaattt acaacatatt       480
     gattatttga ataaaaaatc ggattattta gaaaagaaag caggagaatt aaaaaatatt       540
     ctggaacgaa gaggtaatga aaacgcgaaa gaagggaatg ataatgatga aaaaaatata       600
     tataataatg aatatcataa taattgttct atttcaaaga ggggtacttt aaaatttatt       660
     aattcttcga atggtttaaa acattctatt gataatgtta atggtatgat taatgaaaat       720
     gggtttacaa tattttataa aaataaaaaa aaaatgacat atttttggag tgttttagag       780
     ttaccaatta aaatgatagg aagtatagaa caatgttttt attttattta taaaaataat       840
     aatcaaatat tttgtgctga taacaaaata aaagcttatt catggatgaa tagtttaagt       900
     gaagcatcat tgtgttttca ttttggtata aaaggtgttt taattaatag taatataaat       960
     aatattaata aaaatgacga tatgaataat acaaatgatg aaaatgttaa acattctgat      1020
     tttatgaata atattagtaa tggtataaaa caagggaaaa aaaataaaca aaaaaaaatt      1080
     gatgagaatt cattaacggt tgatataaaa cctgaggata caggcacacg tatttttgtt      1140
     aatgatgtgg aacaaaaaat aaacaaggac gtaccaggaa aagataatgt ttttaatttg      1200
     aatgatataa aaaagaaaat ggatgacgaa aggaaaacgc ctcaaagcga aaatgatgaa      1260
     gatcaacaag gagggtatga taaaatggaa gaaaatgaaa aagaagatac tcaaatggac      1320
     aatgacgatt atgaaatgta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page