(data stored in ACNUC9543 zone)

EMBL: AL844507.PE259

AL844507.PE259       Location/Qualifiers
FT   CDS_pept        1146167..1147504
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0826300"
FT                   /product="SPRY domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0826300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0021:mRNA"
FT                   /db_xref="GOA:Q8IB96"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR037353"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB96"
FT                   /protein_id="CAD51111.1"
FT                   /translation="MASTINFFSKEDISNKEENEKEEKKSNNKELLENNKEKSCSGIQK
FT                   TIRLLNLFSNSEKKRKIDNSREEYSDKILEKQSTLSLKDKEQNALNYINNEYVIEKGND
FT                   KLCEEQGQDHQISIASLEDEGSYNKNVTTFERNESNNEKMKDIKNDDIKIKEKINYNKI
FT                   NNDRITYDGKSKKGEEKNKYSKEKTNTHLHVEVEKKDNIKHFFDYNKYRSKCNVTFSMK
FT                   YKDSSVSLSNDKLTCYGDKGWSSVFVNNGADIGKWYYEIKIEEPVQNFNFLGYKDKIIK
FT                   VNPYIRVGFACRYMRYDYPIGTDKYSYCVNSKNGKIFNNSISYDCMEPFNVGDIIGCYL
FT                   NLKNKNSYNFDPRLDKKLYEHLQNGILCDPKNPPLLKKNEGSTIFFSLNGQIKKTSFMD
FT                   IYEGFYHPSVSLYMGASAKINLGPNFTYNHLQDYVPCVYMEPPTVL"
     atggcctcaa cgataaattt tttttccaaa gaagacatta gtaataagga agaaaatgaa        60
     aaagaggaaa agaaatcaaa caataaagaa ttgttagaaa ataataaaga aaagtcctgt       120
     tctggtatac agaaaactat tagattattg aacttattta gtaatagtga aaagaagagg       180
     aaaattgata atagtagaga agaatattct gataaaatat tagaaaaaca aagtacatta       240
     agtttaaaag ataaagaaca aaatgcttta aattatataa ataatgaata tgtgattgaa       300
     aaaggaaatg ataaattatg tgaggagcag ggacaagatc accaaatttc tatagcttct       360
     ttggaggatg agggatcata caataaaaat gttacgactt ttgaaaggaa tgaatctaat       420
     aatgaaaaaa tgaaggatat aaaaaatgat gatataaaaa ttaaggaaaa aattaattat       480
     aataaaataa ataatgatag aataacatac gatggcaaat caaaaaaagg ggaagaaaaa       540
     aataaatata gtaaagaaaa gacaaacacg catttacatg tagaagtaga aaaaaaggat       600
     aatataaaac atttctttga ttataacaaa tataggagta aatgtaatgt aaccttttca       660
     atgaaatata aagatagttc tgtaagtcta agtaatgata agttaacttg ttatggtgat       720
     aaaggatggt caagtgtttt tgtaaataac ggtgcagata ttggaaaatg gtattatgaa       780
     ataaaaattg aagagcctgt acaaaatttc aattttttag gatataaaga taaaattata       840
     aaagtcaatc catatataag agttggtttt gcttgtagat atatgagata tgattatcct       900
     ataggtacag ataaatatag ttattgtgtt aatagtaaaa atggtaaaat atttaacaat       960
     tctattagtt atgattgtat ggaacctttt aatgttggtg atattattgg atgttattta      1020
     aatttaaaaa ataaaaattc atataatttc gatccaagat tagataaaaa gctatatgaa      1080
     catttacaaa atggaatatt atgtgatccc aaaaatccac ctctcttaaa aaaaaatgaa      1140
     ggttcaacta tattcttttc tttaaatgga caaataaaaa agacatcctt tatggatatt      1200
     tatgaaggat tttatcatcc ttctgtaagt ttatatatgg gagcatcagc taaaattaac      1260
     ttgggcccta attttacata taatcatttg caggactatg tcccatgtgt atatatggag      1320
     cctcccaccg tattataa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page