(data stored in ACNUC9543 zone)

EMBL: AL844507.PE262

AL844507.PE262       Location/Qualifiers
FT   CDS_pept        complement(1157321..1158151)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0826600"
FT                   /product="SNARE protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0826600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.21:mRNA"
FT                   /db_xref="GOA:Q8IB99"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB99"
FT                   /protein_id="CAD51108.1"
FT                   /translation="MFILSDDDVAYSNSINSEEIEESDYENSEAHSRYYEETDEEESNN
FT                   NDIDDEDLCLFKYVCIGSLDDVDILLKYSLFNRDIDKSANFIVKKILIASKKKLNYCNK
FT                   KILNWDNHIIYFIICTDKKLALFLIGLDLKASFKNYAFEFLRKLEIYAKSNLFYDKNYV
FT                   SSHVNPSKVHTIECFMKTTIKNLNKCCKNEKLFAVKQKLNKINSVMNNHIDTLYKSRGN
FT                   IKALQYKTEDMSKNTLNFVQNTKKLKRIMFLKYWKTYFLCACFLIIGFKVYRSI"
     atgtttattc tttcagatga tgatgttgca tattccaata gtataaacag tgaagagatt        60
     gaagaaagcg attatgagaa tagcgaggca cattcaagat attatgaaga aacagatgaa       120
     gaagaaagta ataataatga tatagatgat gaagatttat gtttatttaa atatgtatgt       180
     ataggttctt tagatgatgt agatatatta ttaaaatata gtctttttaa tagagatata       240
     gataaatcag caaattttat tgtgaaaaaa atattaatcg catccaaaaa aaaattaaat       300
     tattgtaata aaaaaatatt aaattgggat aatcatataa tatattttat tatatgtaca       360
     gataaaaaac ttgcattatt tttaataggt ctagatttaa aagcatcatt taaaaattat       420
     gcattcgaat ttttaagaaa acttgaaata tatgctaagt ctaatttatt ttatgataaa       480
     aattatgtat caagtcatgt aaacccatca aaagttcata ctattgaatg ttttatgaaa       540
     accacaatta aaaatttaaa taaatgttgt aaaaatgaaa aactttttgc tgttaaacaa       600
     aaattaaata aaattaattc agttatgaat aatcatatag ataccttata caaatccaga       660
     ggaaatatta aagccttaca atataaaacg gaggatatgt caaaaaatac tttaaatttt       720
     gtacaaaaca cgaaaaaatt aaaaagaatt atgttcctta aatactggaa aacttatttt       780
     ctatgtgctt gctttttaat cataggattt aaggtatata gatccattta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page