(data stored in ACNUC9543 zone)

EMBL: AL844507.PE264

AL844507.PE264       Location/Qualifiers
FT   CDS_pept        join(1164655..1164669,1164761..1164799,1165001..1167205)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0826900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0826900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.20:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Y1"
FT                   /protein_id="CAX64159.1"
FT                   /translation="MNSIKGSAKELFKHLKDELIQQNNTYSYDEDSNIISSTHSNDEEY
FT                   YEDIKYLKKEQLKAYICKLRKELRNYKMRELHLLSEIKYLKRKVTRLNDLIEHDNILLR
FT                   GNRKGSNSLKYYDDNYSNKSYEQGGEISSCYMKTSEGKYLIKKNRFLYDSKNTIHNFHK
FT                   KHRDFSINSINESINNCRRNRSMSNTLLYKQSKQQNKQQHQRQGGKGWGLELGREEDSS
FT                   NMLHNITSKSVYSLKNINGYNNDNINTILYRNKYNSNNSTSSYYINNNNNNMKRYNSST
FT                   SLLCSNKNINLSRKSLISNTMHNNKTNNIFSSNRSLASFSKYELKQHLISNSKHKRDNL
FT                   LTNKINHNITRDIQNYHKTRQRILSNNNISEKSTGTLLNKLSTLNNKNKHGQKILPKNN
FT                   INIKCNIMNHKGNNNPNECPSNIITKPISNDKEKKKKKKKKKKKKNCYEDMFHFKHHQN
FT                   ILNKKYTSSYEYTKNKTKQNKENMINKNVKSISQKKENNIQSVEATQHNLQQIKNDSKI
FT                   QNNNNMSDENNSFVLDPLVSDENKHQKEIKDVKPINDDVNKTSGRLNEQTNLQNVTSEK
FT                   NMTYTSKSNHDSFISSENERVKEYLNKCRLKQKNKINTEQKNKINTEQKKSEKQPSLNT
FT                   ITKESRNSKLIGLKQHIDIEIKENFRKELDELKKRNNNIILKPSNFYNFPMDTSSSNTS
FT                   DNSDNNICHKKENINDMKCTKYNVKTNPLKESTLLNISFNCIDKRITNLQNYLKNTKR"
     atgaatagta taaagggttc tgctaaggaa ttgtttaaac atttaaaaga cgagctcata        60
     caacaaaata atacttactc atatgatgag gactctaata taatttcttc tactcattcc       120
     aatgatgaag aatactatga ggacataaaa tatttaaaaa aagaacaatt aaaagcatat       180
     atatgtaaat tgagaaagga actaagaaat tataaaatga gagaattaca tttacttagt       240
     gaaataaaat atttaaaaag aaaagtcaca agactcaatg atttgataga acatgataat       300
     atattattaa gagggaatag aaaaggtagt aattctttaa aatattatga tgataactat       360
     agtaataaat cgtatgaaca aggtggagaa atatcttctt gttatatgaa aacatcagaa       420
     ggaaaatatt taataaaaaa gaacaggttt ttatatgata gtaaaaatac aattcataat       480
     tttcataaaa aacatagaga tttttctatt aatagtataa atgaaagtat aaataattgt       540
     cgaagaaata gatctatgtc gaatacatta ttatataaac aaagcaaaca acaaaacaaa       600
     caacaacatc aacgtcaagg aggaaaaggt tggggattag aattaggaag ggaagaagac       660
     agtagtaata tgttacataa tattacaagt aaatctgttt attctttaaa aaatataaat       720
     ggatataata atgataatat taatacaatt ctttatagga ataagtataa cagtaataat       780
     tcaacatcat cttattatat taataataat aataataata tgaaaagata taatagttca       840
     acatctttac tatgtagtaa taaaaatata aacttatcaa gaaaaagtct tataagtaat       900
     acaatgcata ataataaaac aaataatatt ttttcatcaa atagaagcct tgcctctttt       960
     tcaaaatatg aattgaaaca gcaccttatt agtaacagta aacataaaag agataatttg      1020
     ttaacaaata aaattaacca taacataaca agagatatac aaaattatca taagactcga      1080
     caaaggattt tatcaaataa taatatatct gaaaaatcca caggcacatt gttaaataaa      1140
     ttgtctacat tgaataataa aaataaacat ggtcaaaaaa tattaccaaa gaataatatt      1200
     aatataaaat gtaatatcat gaatcataaa ggtaataaca atccaaatga atgccctagt      1260
     aatataataa caaaacctat ttctaatgat aaagaaaaaa aaaaaaaaaa aaaaaaaaaa      1320
     aaaaaaaaaa aaaattgtta tgaggacatg tttcatttta aacaccatca aaatatttta      1380
     aataaaaaat atacatcatc ttatgaatat acaaaaaaca aaacaaaaca aaataaagaa      1440
     aatatgataa ataaaaacgt aaaaagcata tcacaaaaaa aagaaaataa tattcaatcc      1500
     gtagaagcta cacaacataa tttgcaacaa ataaaaaatg actcaaaaat ccaaaacaat      1560
     aataatatgt cagatgaaaa taattcattt gtgttggatc cattggtatc tgatgagaat      1620
     aagcaccaaa aggaaataaa agatgttaaa cctataaatg atgatgttaa taaaacatca      1680
     ggacgtttaa atgaacaaac gaatctacaa aatgttacaa gcgaaaagaa tatgacatac      1740
     acttcaaaga gtaaccatga tagttttata tcttcagaaa atgaaagggt taaagaatac      1800
     ttaaataaat gtagattaaa acaaaaaaat aaaataaata ctgaacaaaa aaataaaata      1860
     aatactgaac aaaaaaaaag tgagaaacaa ccatctttaa ataccataac aaaagaaagt      1920
     aggaatagca aattgatcgg cttaaaacaa catatagaca tagaaataaa ggaaaatttt      1980
     agaaaagaac tggatgaatt aaaaaaaaga aataataata ttattttaaa accttccaac      2040
     ttttataatt ttcctatgga tactagtagt agtaatacta gtgataattc tgataataat      2100
     atatgccata aaaaggaaaa tattaacgat atgaaatgta ctaagtataa tgtaaaaaca      2160
     aatcctttaa aggaatcaac actattaaat atatccttta attgtattga taaaaggata      2220
     accaatttac aaaattattt gaaaaataca aagaggtaa                             2259
//

If you have problems or comments...

PBIL Back to PBIL home page