(data stored in SCRATCH zone)

EMBL: AL844507.PE268

AL844507.PE268       Location/Qualifiers
FT   CDS_pept        1181295..1183796
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0016:mRNA"
FT                   /db_xref="GOA:Q8IBA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA5"
FT                   /protein_id="CAD51102.1"
FT                   /translation="MVLPLLFINYKNNKYKNEYAYKHVVKCYNLPEFMYEGFFEFLIKK
FT                   YNNEDLYKIDEIIKPSYEETKLYPLKIICNKNLGNFLIKKEKILVVDDIMENNKVYIKI
FT                   DNDKNEYNNNDDVIYDNIHINVEDKKECIQKVSFENNMYIDQGKKTKTEDKQYINNNIF
FT                   NDLVDNSNVTLKEDNNVTSGDYAYINVHNCVNDENYMMNKRNVQSIERDINKNKKEVQY
FT                   CEYVDDEMNNLPHNNNNKKNNNNNNNNNNNNDNIYENKYDYYSCCYSDQFDESDSDYSV
FT                   ICAHNNNNNIITCHETCSYNDEHQKYKNKNVKYIEDENNNTGDYASNTSETKSGYSSYK
FT                   YNNIINYKNNQKNNKKCKKIFYIYFVEGNVQEFIQDINEEDKNKIEEDIIDKILNEEKE
FT                   NINKKHVENDTYNINNKNNSIQGYIYNLHNQNCYQDNEEYVNSAEMETGRINQEDKSDI
FT                   SLSTCCMQSEKNKENEKYDKFVQNKENETYDKFVQNKENEKYDKFVQNKENEKYDKFVQ
FT                   NKENEKYDKFVQNKENETYDKFVQNKENEKYDKFVQNKENEKYDKFVQNKENEKYDKFA
FT                   QNKENEKYDKFVQNNKNEEHMLDDNKEKDLIHSSMRSDYSNTNVKENDMKVIWPNKLSW
FT                   KEISNEIKKKLCVVIKNKPAEWNHYDLQNFLVSQFHNKNYIPTFQDIFITKSCPTIATV
FT                   AFKNEEERNYFLDHQKFKLPNLKHHHKDLNKNNIYYNKYSNFLVLQEYVISYNTQSNNN
FT                   PKKYYQDKYEQNIYKDYESRQKRKYNNFYDHYNHNFHSKKYSDVSINKYKKKINFNNNY
FT                   DINSNVKRKKVSTSYERNDDS"
     atggtgttac cattattatt tataaattac aagaataata aatacaagaa tgaatatgca        60
     tataagcatg tagtaaaatg ttataacctt cctgaattta tgtatgaagg tttttttgaa       120
     tttttaataa aaaaatataa taatgaggac ttatataaaa tagatgagat tataaaaccg       180
     tcatatgaag aaacgaagtt atatccactc aaaataattt gtaataaaaa tttaggtaat       240
     tttttaataa agaaagaaaa gatcttagta gtcgatgata ttatggaaaa caataaagtg       300
     tatattaaaa tagataatga taaaaatgaa tataataata atgatgatgt tatttatgat       360
     aatattcata taaatgtgga agataaaaaa gaatgtatac aaaaagtttc ttttgaaaat       420
     aatatgtata tagatcaagg gaaaaaaaca aaaacagaag acaaacaata tataaataat       480
     aatattttta atgatcttgt ggataattct aatgttactc tgaaggaaga taataatgta       540
     acatccggtg attatgctta tataaatgta cataattgtg tgaatgatga aaattatatg       600
     atgaacaaaa gaaatgttca aagtattgag agggacataa ataaaaataa aaaggaagta       660
     caatattgtg aatatgttga cgatgaaatg aataatctcc cacacaataa taataataaa       720
     aaaaacaaca acaataataa taacaacaat aataataatg acaatattta tgagaataag       780
     tatgattatt atagttgttg ttatagcgac caatttgatg aaagcgattc agactattct       840
     gtcatatgtg ctcataataa taataataat attatcacat gtcatgagac atgctcttat       900
     aacgatgaac atcaaaaata taaaaataaa aacgtaaaat atatagaaga tgaaaataat       960
     aacacaggtg attatgcctc caatacatcc gagaccaaaa gtggatatag ctcatacaaa      1020
     tataataata ttataaatta taaaaacaac caaaaaaata ataaaaaatg taaaaaaata      1080
     ttctatatct atttcgttga aggaaatgta caagaattta ttcaagatat aaacgaagaa      1140
     gataaaaata aaatagaaga agatattatc gataaaattt taaatgaaga aaaggaaaat      1200
     ataaataaaa agcatgtgga aaatgataca tataatataa ataataaaaa taattcaatt      1260
     caaggatata tatataattt gcacaatcaa aattgttatc aagataatga agaatatgta      1320
     aattctgctg aaatggaaac ggggagaata aaccaggaag acaaaagtga catatcgtta      1380
     tctacatgtt gtatgcaaag tgaaaaaaat aaagaaaatg aaaaatatga taaatttgta      1440
     caaaataaag aaaatgaaac atatgataaa tttgtacaaa ataaagaaaa tgaaaaatat      1500
     gataaatttg tacaaaataa agaaaatgaa aaatatgata aatttgtaca aaataaagaa      1560
     aatgaaaaat atgataaatt tgtacaaaat aaagaaaatg aaacatatga taaatttgta      1620
     caaaataaag aaaatgaaaa atatgataaa tttgtacaaa ataaagaaaa tgaaaaatat      1680
     gataaatttg tacaaaataa agaaaatgaa aaatatgata aatttgcaca aaataaagaa      1740
     aatgaaaaat atgataaatt tgtacaaaat aataagaatg aggaacacat gcttgatgat      1800
     aataaagaaa aagatttgat acattcttca atgagatcag attatagtaa tacaaatgta      1860
     aaagaaaacg atatgaaagt tatatggcca aataaattat catggaaaga gatatcaaat      1920
     gaaataaaaa aaaaattatg tgttgttata aaaaataaac cagctgaatg gaatcattat      1980
     gatttacaaa attttttagt atcccaattt cataataaga attacattcc aacattccaa      2040
     gatattttta taacaaaaag ttgtccgacc atagcgacag tagcatttaa aaatgaagaa      2100
     gaacgaaatt atttcttaga tcatcaaaaa tttaagttac ccaatttgaa acatcatcat      2160
     aaagatttaa ataaaaataa tatttattat aataaatatt caaatttctt agttctacaa      2220
     gaatatgtaa tctcatataa tactcaaagt aataataacc ctaaaaaata ttatcaagat      2280
     aaatatgaac aaaacatata taaagattat gaatcaaggc aaaaaagaaa atataataat      2340
     ttttatgatc attataatca taattttcat tcaaaaaaat attcagatgt atctattaat      2400
     aaatataaaa aaaaaattaa ttttaataat aactatgata taaatagcaa tgtcaaaagg      2460
     aaaaaagtat ctacgtcata tgaaagaaat gatgattctt ag                         2502
//

If you have problems or comments...

PBIL Back to PBIL home page