(data stored in SCRATCH zone)

EMBL: AL844507.PE269

AL844507.PE269       Location/Qualifiers
FT   CDS_pept        1184595..1185251
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827400"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0015:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA6"
FT                   /protein_id="CAD51101.1"
FT                   /translation="MRKESFLFFICTLNLLINSFFCYGGKVKKNKHLRNLLKTLTDRIE
FT                   TNDGENEYARLTQTPVINMNLEKTIFKTSLQDILVEPYAEKIKEIISKNNYEISKEKEN
FT                   LDEIRYYNDNLDKINNILIERENEKKKKKRKNIQLENKLRNKYFHYLQDQDYGFSIFPV
FT                   YKTFESNPLHFDNNIISSLLPHELLDKGILLNKQILENSEKILHYPERGDTLYEI"
     atgagaaaag aatccttttt attttttatt tgcacattaa acttgttgat aaattccttt        60
     ttttgttatg gcggaaaagt aaaaaagaat aagcacctga ggaatttact aaaaacattg       120
     acggatagga ttgagacaaa cgacggagaa aacgaatatg cacgtttaac acaaacacct       180
     gttataaata tgaatttaga aaaaacaatt tttaagacat ccttgcaaga cattcttgtt       240
     gagccttatg cagaaaagat taaagaaatt atatcaaaaa ataattatga aataagtaag       300
     gagaaagaaa acttggatga aataagatat tataatgata atttagataa aataaacaat       360
     atattaatag aacgagaaaa tgaaaaaaaa aagaaaaaaa gaaaaaatat tcaactagaa       420
     aataaattac gaaataaata ttttcattat ttacaagatc aagattatgg atttagtatt       480
     ttccctgtgt ataaaacttt tgaatccaat ccattacatt ttgataataa tataattagc       540
     tcattattac cacatgagtt actagataag ggtattttgt taaataaaca aattttagaa       600
     aattctgaaa aaattcttca ttatcctgaa aggggcgata cactatacga aatataa          657
//

If you have problems or comments...

PBIL Back to PBIL home page